KEGG   Camelina sativa (false flax): 104726298Help
Entry
104726298         CDS       T05044                                 

Definition
(RefSeq) (DL)-glycerol-3-phosphatase 2-like
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
csat  Camelina sativa (false flax)
Brite
KEGG Orthology (KO) [BR:csat00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:csat01009]
    104726298
Enzymes [BR:csat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     104726298
Protein phosphatases and associated proteins [BR:csat01009]
 HAD phosphatases
  Other HAD phosphatases
   104726298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_6 HAD Hydrolase_like
Motif
Other DBs
NCBI-GeneID: 104726298
NCBI-ProteinID: XP_010443430
Position
11
AA seq 239 aa AA seqDB search
MSTPADVAGRGSITHVIFDMDGLLLDTEKFYTEVQEIILARFNKTFDWSLKAKMMGRKAI
EAARIFVEESGISDSLSAEDFLVEREAMLQDLFPTSKLMPGASRLIKHLHAKNIPICIAT
GTHTRHYELKTQRHRELFSLMHHVVRGDDPEVKQGKPAPDGFLAAARRFKVGPVDPQKVL
VFEDAPSGVLAAKNAKMNVVMVPDPRLDISHQDVADQILTSLLDFKPEEWGLPPFEDSN
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactccagctgacgtcgcgggcagaggatcaatcactcatgtcatattcgacatg
gacggtcttcttctcgatactgagaagttctatactgaggtccaagaaatcatacttgct
agattcaacaaaacatttgattggtctctcaaggctaagatgatgggtagaaaagctata
gaagctgccaggatttttgttgaagaaagcgggatcagtgattctctttcagctgaggac
ttccttgtcgagagggaggcaatgttgcaagaccttttccctactagtaagctaatgcca
ggggctagccgactaatcaagcatcttcatgcaaagaatattccaatttgtattgctaca
ggtactcatacacggcattatgaactaaaaacccaaagacacagagagcttttctcattg
atgcatcacgtagttcgcggtgatgatccagaggtgaagcaaggaaagcctgccccagat
ggctttctcgctgcagctaggagatttaaggtcggtcctgtagatccacaaaaggttctg
gtattcgaagacgctccatctggagttcttgctgctaaaaatgccaaaatgaacgtggtc
atggtgccggatcctagactagatatctctcaccaagatgttgcagaccaaatcctaacc
tctctactcgattttaaaccggaagaatggggtttgcctccgtttgaagattcaaactag

DBGET integrated database retrieval system