KEGG   Camelina sativa (false flax): 104726973Help
Entry
104726973         CDS       T05044                                 

Definition
(RefSeq) glutamate-1-semialdehyde 2,1-aminomutase 1, chloroplastic
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00860  Porphyrin and chlorophyll metabolism
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
Module
csat_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    104726973
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:csat01007]
    104726973
Enzymes [BR:csat01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     104726973
Amino acid related enzymes [BR:csat01007]
 Aminotransferase (transaminase)
  Class III
   104726973
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 104726973
NCBI-ProteinID: XP_010444259
Position
11
AA seq 473 aa AA seqDB search
MSATLTGSGTALGFSCSSKISKRASSSSTNRCCIKMSVSVDEKKKSFTLQKSEEAFNAAK
NLMPGGVNSPVRAFKSVGGQPVLIDSVKGCKMWDIDGNEYIDYVGSWGPAIIGHADDEVL
AALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTNK
EKFIKFEGCYHGHANAFLVKAGSGVATLGLPDSPGVPKAATSDTLTAPYNDLEAVEKLFA
AHKGEISAVILEPVVGNSGFIPPTPEFINGLRQLTKDNGVLLIFDEVMTGFRLAYGGAQE
YFGITPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTL
KRLQQPGTYEYLDKITKELSNGILEAGKKTGHPMCGGYISGMFGFFFAEGPVYNFADAKK
SDTEKFGRFFRGMLEEGVYFAPSQFEAGFTSLAHSPKDIEFTIAAAERVLSSI
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcgacgcttacaggatcgggaactgctctagggttttcgtgctcctcgaagatc
tccaagagagcttcttcttcttctactaaccgatgctgcatcaagatgtctgtttccgtc
gacgagaagaagaaaagtttcactcttcagaaatcagaggaagctttcaatgctgccaag
aatctaatgcctggaggtgtgaattcccctgttcgagccttcaaatccgttggtggtcaa
ccagttttgatcgattcagttaaaggctgtaagatgtgggacattgatggtaatgagtac
attgactacgttggatcttggggaccagctattattggtcatgctgatgatgaggtactc
gcggctttaggtgagacgatgaagaaaggaacaagctttggtgctccttgtctcttagag
aatgttttagctgagatggttatatcagctgttccaagcattgaaatggttcgctttgtc
aactctggtactgaagcttgtatgggtgtgctccgtctcgccagagccttcactaacaaa
gagaagttcatcaagtttgaagggtgttaccacggtcacgctaacgccttccttgttaaa
gctggtagtggtgttgctactttagggctaccggactcacctggtgtccctaaagcagct
acttcagatacgttgactgctccatacaacgatcttgaagctgttgagaagctttttgcg
gctcataaaggcgagatctccgcggttattctcgaacctgttgttggtaactctggattc
atccctccaacaccggagttcatcaacggtttacgccagctcacaaaagacaacggtgtt
cttctcatcttcgatgaagtcatgacaggctttcgtttagcctatggtggtgcccaagaa
tactttggaatcacgcctgatctaacaactcttggaaaaatcattggtgggggtcttccc
gtgggagcatacggtgggagacgtgatattatggagatggttgcgccagcaggaccgatg
taccaagctgggactctaagtggtaatccactggcaatgaccgcagggattcacacgctg
aagcggctacaacagccaggaacatacgagtatttggacaagatcacaaaggagctaagc
aacggaatcttagaagcaggaaagaaaacagggcatccaatgtgcggtggttacataagt
ggtatgttcggtttctttttcgcagaaggaccggtctacaactttgcagatgcaaagaag
agcgacaccgagaagtttggtaggtttttcaggggaatgttggaagaaggtgtttacttt
gcaccgtctcagttcgaggccgggtttacgagcttggctcacagtcccaaggatatagag
ttcacgattgctgcggccgagagggtccttagtagtatctag

DBGET integrated database retrieval system