KEGG   Camelina sativa (false flax): 104729283Help
Entry
104729283         CDS       T05044                                 

Definition
(RefSeq) gamma-glutamyltranspeptidase 2-like
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00430  Taurine and hypotaurine metabolism
csat00460  Cyanoamino acid metabolism
csat00480  Glutathione metabolism
csat00590  Arachidonic acid metabolism
csat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    104729283
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    104729283
   00460 Cyanoamino acid metabolism
    104729283
   00480 Glutathione metabolism
    104729283
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:csat01002]
    104729283
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:csat04090]
    104729283
Enzymes [BR:csat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     104729283
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     104729283
    3.4.19.14  leukotriene-C4 hydrolase
     104729283
Peptidases and inhibitors [BR:csat01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   104729283
CD molecules [BR:csat04090]
 Proteins
  104729283
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 104729283
NCBI-ProteinID: XP_010446520
Position
12
AA seq 580 aa AA seqDB search
MMNSMSFIRTATIAFLIIVFLQNASAGHKKPRNIVTRHGAVATDDRRCSKIGRNVLRQGG
NAIDASVAAALCLGVVSAASSGIGGGAFAVIKLANGKEIAYDSRETAPLSATENMYGDNP
DKKKKGALSVGVPGEVAGLFTAWKEHGKLSWKRLVSPAKKLAAHGFKISKYLYMQMNATR
SDILTDKGLSEVYVSNGELKKPGTICRNPKMAFTLSQIAEHGPKAFYNGTVGAYLVSDIQ
KAGGIITMKDLQNYKVKVTEPLSADVLGYRLLGMPPPSSGGAAMVLILNILAQYGVPSGV
SGPLGVHRLVEALKHAFAVRMNLGDPDFVPNVSKVVKDMLSPKFAQKLKRKINDKKTFDP
KNYGGKWNQINDHGTSHLSVMDSERNVVSMTSTINGYFGAHMMSPSTGMVLNNEMDDFSI
PMKSGGDLDVPPPAPANFIRPGKRPLSSMTPTIVLKDGKVKAALGASGGMYIIAGTTEVF
LNHFVHNMDPLSSVAAPRIYHQLIPNRVQYENWTTVYNDHFKIPKETRLELEKKGHVLAP
FAGGTISQLIVVQEPDKSSGGRSKLVAVSDPRKGGYPSGY
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgatgaattcaatgtctttcattcgtactgcgacgatcgcttttcttataatcgtgttt
ctgcaaaacgcttcggcgggtcacaagaaaccgcgaaacattgttacgcgtcacggtgcg
gttgcgacggacgacaggcggtgttctaaaatcgggaggaatgttcttcgtcaaggagga
aacgcgattgatgcgtcggtcgctgctgctctttgtttgggcgtcgtgagtgcagcgtct
agcggtattggtggtggagcgtttgcagttattaagcttgctaatggcaaggaaattgct
tatgactctagagaaaccgctcctctaagcgccactgagaatatgtatggtgataatcct
gacaaaaagaagaaaggagccttgtcagtaggtgttcccggggaagtcgcgggtctattc
acggcttggaaagaacatgggaaactatcgtggaagcggttagtgagtcctgcaaagaaa
cttgcagctcatggattcaagatttcaaaatatctctatatgcagatgaacgcgactaga
agcgatatcttaacggacaaaggtctctctgaggtatatgtttcaaacggagagctcaag
aaaccagggactatttgccgtaacccaaagatggcttttacactgagccaaatcgctgaa
cacggtccaaaagcgttttacaatggcacggttggggcttaccttgtaagtgatatacaa
aaagccggtgggataataactatgaaagatttgcagaattataaagtgaaggttacagaa
ccattatctgcggacgttcttggttaccgtctactcggtatgcctcctccatcatccggt
ggcgctgcaatggtccttattttgaatattcttgctcaatatggtgttccatcgggtgtt
tctggcccacttggtgttcatcgactagtggaggctctcaaacatgcattcgcggttagg
atgaacctcggggatccagatttcgtccccaatgttagtaaggttgttaaagatatgtta
tctccaaagtttgcacaaaagttgaagagaaagattaacgacaagaaaacctttgatcct
aaaaattacggtggcaaatggaatcagatcaatgatcatggcacgagccatttatcggta
atggattcggagagaaatgttgtttcaatgactagtacaatcaacggatatttcggggca
cacatgatgtctccgagcaccggaatggttctaaacaatgaaatggatgatttctcgatc
cccatgaaatccggaggtgatctagatgtgccgccaccggcaccggctaacttcatccgt
cccggaaaacgacctttgtcctctatgactcccaccattgtactcaaggacggtaaagta
aaagccgcattgggtgctagtggaggaatgtacatcattgccggcacaacagaagttttc
ttgaatcatttcgtccacaacatggatcctctctcttccgttgcggctccaagaatctac
caccagctgattccgaacagagttcagtatgagaattggacaacagtgtataatgaccat
ttcaagattcccaaagagacaagacttgagttggagaagaaaggtcatgtcctagcgcca
ttcgcaggaggaacgatatctcagttaatagtggttcaagaacccgataaaagttctggt
ggtaggagtaagcttgtggcagtaagtgatccaagaaaaggagggtacccttcaggatat
tga

DBGET integrated database retrieval system