KEGG   Camelina sativa (false flax): 104729292Help
Entry
104729292         CDS       T05044                                 

Definition
(RefSeq) photosynthetic NDH subunit of lumenal location 4, chloroplastic-like
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
csat  Camelina sativa (false flax)
Brite
KEGG Orthology (KO) [BR:csat00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    104729292
Enzymes [BR:csat01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     104729292
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C SR-25
Motif
Other DBs
NCBI-GeneID: 104729292
NCBI-ProteinID: XP_010446528
Position
12
AA seq 224 aa AA seqDB search
MAISTLTLTQSLYTRSVHRPTIFSSSSSSSSSSSSSSFSCLCSSSTDCEPKLSVKKRVFG
MGLGLLAASILSLTPMDADATRIEYYATVGDPLCEYSYAKSGLGFCDLDVGFGDEAPRGV
MVNIHYTARFADGTLFDSSYKRARPLTMRIGVGKVIRGLDQGILGGEGVPPMRVGGKRKL
QIPPQLAYGPEPAGCFSGDCNIPGNATLLYDINFVEIYPGSNTR
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcgatttctactttaacacttacacaatctctctatacacgttcagttcaccgaccc
accatcttctcttcttcttcttcttcttcttcttcttcttcttcctcgtcattctcatgt
ctctgttcttcttccactgactgcgagccgaaactttcagtaaagaaacgcgttttcgga
atgggtttagggttattagctgcttcgattctctctctaacacctatggacgcagacgcc
acgaggattgagtactacgctactgttggagaccctctctgcgaatacagctacgcaaaa
tcgggacttggattctgcgatctcgatgttgggtttggtgatgaagcccctcgtggtgta
atggtcaatatccattacacagcgaggtttgctgatgggacgttgtttgatagtagctat
aagcgtgcaagaccacttactatgcgaattggggtcggcaaggttattaggggtctagac
caagggattcttggaggggaaggagtgccacctatgcgagtaggtggaaagcgtaaactt
cagattccacctcagttagcttatggaccagagcctgcaggatgcttttccggtgactgt
aacatacctggaaatgcaactttgctatatgatatcaactttgttgagatctaccctgga
agtaatacaagatga

DBGET integrated database retrieval system