KEGG   Camelina sativa (false flax): 104731195Help
Entry
104731195         CDS       T05044                                 

Definition
(RefSeq) separase isoform X1
  KO
K02365  separase [EC:3.4.22.49]
Organism
csat  Camelina sativa (false flax)
Brite
KEGG Orthology (KO) [BR:csat00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:csat01002]
    104731195
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csat03036]
    104731195
Enzymes [BR:csat01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     104731195
Peptidases [BR:csat01002]
 Cysteine Peptidases
  Family C50: separase family
   104731195
Chromosome and associated proteins [BR:csat03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Separase
    104731195
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT
Motif
Other DBs
NCBI-GeneID: 104731195
NCBI-ProteinID: XP_010448795
Position
12
AA seq 2197 aa AA seqDB search
MASADDLRLLSLIDSSSSAGDNVFSSFSDYLKPFSTLSSSTTSRNKKQDRATTVRALAKQ
FLPFLNKSMSLLPKRLSVAKSNDGAREFALGLFRVYELCVDCLELVSAQLACKPHTVQSQ
RLRMIYCLDVWGLYENVYAEGFKVLEKLRGGSDCKSRLLPEVQDGEAQLALVVVDAVNAI
VKAVAMGQHLEDKRCRKVLVLIEEVRPWFRVLDAKASEKLHRGIVANMGKCAVSLVKEAE
HFDEDLVLSFCDLTVKEHYKSALSKDRIYKFAREVLSVLFGLKYRKMSVIIDISMALLRS
LTCQFEDESNENLMDFFDLVAYCAHKFRAAGDMYCAKVSKKLNEMAAIFIEAIPQLNLVL
RLYSTGLSITVCDSKLGESKDKDATDDWKIQALFDDDARWQSLASLLGMVDSYSGDVGNR
TGSSLIGGRKNYNNKRHDCCIERNEKTCRPEYLDALRFLCQPLADLIYSVKRKIVLKTEM
PCASAHLTTIHDAFLQFCDGCLFLQRCTSDKGDRETDNNKALLNVAMGAFIVSLRTQLKV
EISAHVIEVVIASPWIRSQELKYLIATLYNIGIVLYRNKELNKACEALELNSKASWRCVE
LHCQMFVNQSSSSDTDLSEEAIMDFVGEACKRCAFYLDILQQCSRCKIRQSIVHILENWL
SAEHLIRRLQGPEAIVKQWVKIERECHTNLDAADSCTTLYSLLLSSPKKSKRGIGKILEQ
ELIAYEKMFSLSSNLGQVTRITIADILLKDVYVTEDMHIERARILIWKARMTRTSGTEHL
NECICLLSEAISILDEVHHGPNKEGTPSSHMLPIAYCLRAFCTQEAEPNSKKVFQDIRTS
LNLWLRIISLDDSGDSLPTENIIPLLYNMIDLMSVKGCTELHHHIYQLIFRLFKWKNVKL
EVCLAMLWECRRLSHALCLSPISDTFIRTLSENCGDKSTCINFWIDCLKDSKAKLIGFQQ
NFHDLHNNFLRASNKDEGPFQSDITTDDIKDAASELISSASLSGTSSFVAAYLYYDLCER
LISFGKLSEALSYAKEAYRIRTLIFHQKFKYSAEKQFEKHNDAGKISKIRTFGLKNFQVY
GWVATDFWPCGNFLWDVNCCYLSPWSVLQCYLESTLQVGILNDLIGNGLEAETSLSWGKA
ISCSQSLFPFAVAFSSALGNLYHKKQCLGLAEKELQNAKEILIANQRDFSCLKCKLKLEV
QLDKQLGDISRKKVDRVSQTDGFLHAESLFSTALGKVCCSAWKSCIRSHGEDIAEEIVID
RNGGEVLGHKLSKTKLNIKEPTGNRASRRGRRAIPTCLSKDKDLISEPTSRLTRSMRQSL
KEQCQNLSNVPEVMSNNSNFCDRSDGTRGDRVLMDTKNAVLGFCICYKEKCQQCLSEEAT
ESGSLNNLVSLKWELCHRKLASSILVSLGKCLADSGRVHLAHEALLHSISVLFKSNWSSH
NQPSVSQLLEFIRKEVARDEFAVDRAVILYNLCWLNLRNYHCRESRSICCDLSHIPFTKL
VSWLMLAFVLSREVPILFQKVSRLLASLYLLSSSSAEFSFEYDGNELSASHWVSFFHQAS
LGTHISYHFISSLSGKHKSRCLSDKECTEATCSSCMVPEDLDLPRLAPERTEDLVQFARE
FFINLPSSTIICISLLGGALNQLLQELMHIRSPVCAWVLISRLNPESQPVATLLPVDSIL
EDMSDDSANLSSTKATQVESLKGPWLCPWGATVVDEVAPAFKSILEESYASSSTPREDTT
ESRCLWWKKRKKLDHRLGIFLRNIEASWLGPWRCLLLGEWSNYKLPDSVQKKLVNNLKSK
CKMEVNEMLLKVILGGGTENLKGEACVAQLSLRNGCYVGRGGYLYEEDNCKTPTAASNIS
ESRHELALKLIHDAAAKLGQQDEQENREPIILVLDPEVQMLPWENIPILRKQEVYRMPSV
GCISAVLKKRSLQGEPARSHLDSFPLIDPLDSFYLLNPGGDLPETQDMFESWFRDQNFEG
KAGSEPSATELTEALENHDLFLYFGHGSGAQYIPKREIEKLDNCSATFLMGCSSGSLWLK
GCYIPEGIPLSYLLGGSPAIVATLWDVTDRDIDRFGKALLEAWLQERSGSSSEGGCSQCE
SLANELAAMNLKGNNTTKRSRKPSLRNKPAPSNVDDGSGKKIECNHKQRRKIGSFIAAAR
DACTLQHLIGAAPVCYGVPTGITKKKGIDALLPSSSC
NT seq 6594 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgctgacgacctccgtctcctctcactcatcgactcctcctcctccgccggc
gacaatgtcttctcctctttctctgattaccttaaacctttctctactctatcatcatca
acaacttcccggaataaaaaacaagaccgagcaaccaccgttcgagccctagccaagcaa
ttccttcctttcctcaacaaatcgatgtcgctgctaccgaaacgcctctccgtcgccaaa
tctaatgacggagctcgcgaattcgccttgggcttgttccgcgtttatgagctttgcgtc
gattgcttagaattggtctccgcgcagttagcttgtaagcctcataccgttcagtctcag
aggctgcggatgatttattgtctcgatgtttggggtttgtatgagaatgtttatgctgaa
gggtttaaggttctggagaagttaagaggcggctctgattgcaaatcccggttgttacct
gaggttcaggatggtgaggcgcagctggctttggtcgttgttgatgcggtgaatgccatt
gttaaggctgtggcaatgggtcagcacttagaagataagcggtgtaggaaagtccttgtt
ttgatcgaggaggtcagaccctggtttagggtcttagatgctaaggcgagtgaaaagttg
cacagagggatcgtggcaaatatgggtaaatgtgctgtttccttggttaaagaggctgaa
catttcgatgaggatttggtgctgtctttctgcgacttaactgtgaaagaacactataaa
tctgcattgtcaaaagatcggatttataagtttgctcgcgaggtgctttctgttctgttc
ggattgaagtatagaaaaatgtcagtgatcattgacatttcaatggctttgttgcgcagc
ttaacttgccaatttgaggatgaaagtaatgagaatttgatggacttttttgacctagtc
gcttattgcgcgcacaagtttcgagcagcaggagacatgtactgtgcaaaagtttcaaag
aaattaaatgagatggcagctattttcatagaggcaattccccaacttaatctggttctt
agactgtattcgactgggctgtccatcacggtttgcgattccaagctcggagaaagtaag
gataaagatgcaacagatgattggaagatccaagctttgtttgatgatgatgctagatgg
caaagcttagcttctttacttggcatggttgatagttactcaggtgatgtgggcaatcgg
actggttcatcattgattggtgggcgtaagaactacaacaataaaagacatgattgctgt
atagagaggaacgagaagacttgtcggccagaatacttagatgccttgagattcttgtgc
caaccgcttgcagacttgatatattcagtgaaaagaaaaattgtgttgaagacagaaatg
ccctgcgcttctgctcatctaactactattcacgatgcctttctccaattttgtgatggc
tgtctcttccttcaaagatgcacgtctgacaagggagatagagaaactgacaataacaaa
gctttgttaaacgtggctatgggtgctttcattgtctcattgagaacccagcttaaagtg
gagatcagtgcccatgtaattgaagttgtaattgccagtccatggatccgatctcaagaa
ctcaagtatctaattgcgacgctttacaatatcggtatcgtattgtacagaaataaggag
ctaaataaggcatgtgaggcgcttgagctgaattccaaggcatcatggagatgtgttgaa
ctacattgtcagatgtttgtaaatcagtctagttcatctgatactgacttgtcagaagag
gccattatggattttgtgggcgaagcatgtaagaggtgtgcattctacctggatatactc
cagcaatgtagcagatgtaagattagacagagtattgttcatattctagaaaattggttg
tcagctgaacatctgattagaaggttacaaggccctgaggcaattgttaagcagtgggtt
aagatagaacgggaatgtcacacgaatctggatgcggctgattcttgtacaactttgtac
tcactgttattatcttctccaaaaaagtcaaagcgtggtatcggaaaaatcctagagcag
gagcttattgcctatgaaaaaatgttctcattaagttcaaatctaggtcaagtaacgcga
atcacgatagcagatatccttttgaaggatgtttatgtcactgaggatatgcatatagag
agagcaagaatcttaatatggaaagcacgaatgacaaggacatctggaactgaacatcta
aatgagtgcatttgtttactgtcagaagcaatctctatattggatgaggtacatcatggg
ccaaacaaagagggtactccatcttctcacatgttacctattgcgtattgcttgagggct
ttctgtacccaggaagctgagccaaactcgaagaaagtttttcaagatattagaacttca
ctaaatctctggctgaggattattagcctagatgatagcggggacagtctaccaacagag
aacataattccgttactgtataatatgattgatttaatgtcagtgaagggatgtacagag
ctccatcatcatatataccagctgattttcagattgtttaagtggaagaatgtcaaattg
gaggtctgccttgcaatgctgtgggaatgtagaaggcttagtcatgccttatgcctttcc
cccataagtgatacctttatccggaccttatcagagaattgtggtgacaaatctacatgc
attaatttctggatagattgcttgaaagattcaaaagcaaagttaattgggttccagcag
aacttccatgatttacataataatttcttgcgtgcctccaataaagatgaaggccccttt
caatcagacatcacaactgatgatattaaagatgcagcttcagaactcatttcaagtgct
tcactctctggtacttcatcttttgtagctgcatatctctattatgatctctgtgaaagg
ctcatatcatttggaaaactttctgaggctctttcatatgcaaaagaagcctataggata
cggactcttatatttcaccagaaatttaagtattcagctgagaagcagttcgaaaaacac
aacgacgctggaaaaatatcaaagatacggacttttggcttaaaaaacttccaagtctac
ggatgggtagcaactgatttttggccatgtggaaattttctctgggacgtcaattgctgc
tacctaagtccttggagtgtactccaatgttatttggaaagcacccttcaggttggaatt
cttaatgatctaatagggaatggactggaggcagaaaccagtctatcatggggaaaagcc
atttcatgctcgcaaagtctattcccttttgcagttgcattttcttctgccttaggaaat
ctttaccacaaaaagcagtgtctgggtctggcagaaaaggaactccaaaatgcaaaggag
atattaattgctaatcagcgagatttttcgtgcctcaagtgcaaactgaagttggaagtt
caattggataaacaacttggagacatatctcggaaaaaagttgatagagtttcccagaca
gatggattcttgcatgctgaaagcttgtttagtactgccctgggaaaagtctgttgctca
gcgtggaaaagctgcatcagatcacatggggaagatattgctgaggaaatagtgattgat
agaaatggaggggaagttttaggacataaattaagtaaaacaaaactcaatataaaggag
ccaacaggaaacagagcctccagaaggggtcgaagagctatcccaacttgtttgtcaaag
gacaaggatttgatatctgagccaacgtcaaggttgactcgatctatgcgtcagtcactt
aaagagcaatgccaaaacctttccaatgtgcctgaagttatgtcaaataactctaatttc
tgtgatagatctgatggtactaggggtgatagggtgctcatggacacaaaaaatgcagtc
cttggcttttgcatttgctacaaagagaaatgtcagcagtgcctgtccgaagaggcaaca
gaatctgggtctctcaacaatttagtaagtttgaaatgggaactctgccataggaagctt
gcgtcctcaatacttgttagccttggaaaatgtttggcagactctggtagagttcatcta
gctcatgaggctttactgcatagtatctctgttttatttaaaagcaactggtccagccac
aaccagccttctgtcagtcagctgctggagtttattaggaaagaagttgcaagagatgaa
ttcgctgttgatcgtgcagtaatactatacaacttgtgctggttgaatttgcggaattac
cactgcagggagagtaggtctatttgctgtgatctgtctcatattcctttcacaaaactg
gtgtcatggttaatgttagcatttgtactcagcagagaggttccaatattatttcaaaag
gtttcaagattgcttgcctctttatatctgctttcttcatcgagtgctgaattctcattc
gaatatgatggaaatgagctatcagcaagtcattgggtctcatttttccatcaagcctcg
cttggtacccatatcagttaccatttcatttcaagtttgagtggaaaacacaaatcacgg
tgcctctcagataaagagtgcacagaggctacttgctcgagctgcatggttcctgaggat
ttggacttacccaggcttgctcctgagcgtactgaagatcttgtacaatttgctagagaa
tttttcatcaatcttccaagctctacaatcatctgcattagtttgcttggaggtgcttta
aaccaactgttacaggagctaatgcacattcgttcacctgtttgtgcctgggtgctcata
tcacgcctaaacccagaaagccaaccggttgccacacttctacctgtagattcgatttta
gaagacatgtcagatgacagtgcaaatcttagctctacgaaagcgactcaagtcgagagt
ttaaaagggccctggctttgtccatggggtgccaccgtggttgatgaggtagctccagca
tttaaatcaatattggaggaaagctacgcatcatcttctactcctagagaagacacaaca
gagagtagatgtctgtggtggaaaaagagaaagaaacttgatcatcgcctgggaatattt
ctaaggaatatagaagcttcctggctgggtccctggaggtgtctgcttcttggagaatgg
tcgaactacaaattgcctgactcagtgcaaaaaaagctggtgaataatctcaagtccaag
tgcaaaatggaagtaaatgagatgcttttgaaagttattcttggtggtggtacggaaaac
ttaaaaggagaagcatgtgttgctcagctttctttaagaaatggttgctatgtaggtaga
gggggatatctttacgaagaagataactgtaaaactcctactgctgcgtctaatatatct
gaaagtaggcatgaattggccttaaaactgatacatgacgcagcagccaaactagggcaa
caagacgaacaagaaaacagagaacctatcattcttgtgttagatccggaggttcagatg
cttccttgggagaatattccaatactaaggaaacaagaggtgtaccgcatgccttctgta
ggttgcatatctgctgtgctaaagaagcgcagtctccaaggagagccagcaagatctcat
cttgattccttccctcttattgatccgctagattcattttacttgttgaatcctggtggt
gatctccccgaaacacaagacatgtttgagagttggttcagagatcaaaactttgagggg
aaagctggatcagaaccaagtgctacggagttgacagaagcattagaaaatcatgatctc
tttctttactttggtcatggaagtggagcacagtatatacctaagcgtgaaatagagaag
ctagataactgttctgcaactttcttaatgggatgcagtagtggttcactatggctaaaa
ggctgttacattccagaaggcataccactctcttatctactaggtggatctccagccatt
gtggcgactttatgggacgtaacagaccgagacattgatcggtttgggaaagcgttgttg
gaagcatggttgcaggagaggtcaggttcttcatcagagggtggatgtagccagtgtgag
tcattagctaatgaactcgcagccatgaatctaaaaggaaacaacaccaccaagaggtca
aggaaaccgtctttgcggaacaagccagctccatcaaatgttgatgatgggtcagggaag
aagattgagtgcaaccacaagcagagacgtaaaatcggttcatttatagccgcagctcga
gatgcgtgcaccttgcaacacttgattggggctgcaccggtctgttatggtgtaccaaca
ggtatcacaaagaaaaaaggaatcgatgctcttcttccttcttcatcttgttag

DBGET integrated database retrieval system