KEGG   Camelina sativa (false flax): 104731341Help
Entry
104731341         CDS       T05044                                 

Definition
(RefSeq) GPI transamidase component PIG-T isoform X1
  KO
K05292  GPI-anchor transamidase subunit T
Organism
csat  Camelina sativa (false flax)
Pathway
csat00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
csat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    104731341
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16 Lactococcin_972
Motif
Other DBs
NCBI-GeneID: 104731341
NCBI-ProteinID: XP_010449019
Position
1
AA seq 646 aa AA seqDB search
MASLVRSWIPLLILQSFLVAVAFGSKEAEQFSEALLLKPLPDRKVLAHFHFENRAPPSNS
HGRHHHLFPKAISQLVQKFRVKEMELSFTQGRWNHEHWGGFDPLSSMNAKPVGVELWAVF
DVPQSQVDTSWKNLTHALSGLFCASINFLESSTSYAAPTWGFGTNSDKLRYGSLPREAVC
TENLTPWLKLLPCRDKDGISALMNRPSVYRGFYHSQRLHLSTVESGQEGLGSGIVLEQTL
TVVLQPETTSVETNMQPSWSLSSLFGRKVVGSCVLAKSSNVYLQLEGRLGHESKNVDTEI
EAHKLWKNADFDLSLKPDRVLRESSGLLFIFDIDKSSDSEPFDLGLNWKLPSKWSCQQAP
LQASRFLMGSGNERGAIAILLKATESQEKLPGRELTDGRCTIKANIFQIFPWYIKVYYHT
LQIFVDQQQKTDSEVLKKINVSPSTDKVSSGMLEMMLELPCEVKSAAISIEYDKGFLHID
EYPPDANQGFDIPSALISFPSHHASLDFQEELSKSPLLSSFKEKSLVRSYTEVLLVPLTT
PDFSMPYNVITITCTIFALYFGSLLNVLRRRIGEEERFLKSQAGKKTGGVKQLLLRLTAK
IRGRPIEAPSSESPAAESSFLSTKLIFKIILIAGAAAAWQYFSTDK
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggctagccttgttcgatcttggatccctttgttaattttgcaatcgtttttggttgcg
gtcgcttttggatcgaaagaagctgaacaattcagcgaggcattactgttgaagcctttg
cctgatcgaaaagttttagctcacttccatttcgagaaccgagctcctccgtctaattcc
catggccgccatcaccatctcttcccgaaagctatctctcagttggttcagaaattccgg
gtcaaggagatggagctatcttttactcagggtcgttggaaccatgaacattggggagga
tttgaccctctatcaagtatgaacgccaagcctgttggggtagagctgtgggctgtgttt
gatgttcctcagtctcaggttgatacttcttggaaaaacttaacccacgccctgtcaggg
cttttctgtgcttcgatcaactttctagagtcttcaacttcgtatgctgctcctacttgg
gggtttgggacaaattctgacaagctgaggtatggttcactgccacgtgaagctgtttgt
accgagaacttgaccccatggctaaagctgcttccgtgtagagacaaggatggcatttcc
gcactaatgaataggccttctgtttacagagggttttatcattctcagaggttgcattta
tccacggttgaatctggtcaagagggattgggttctggcatagtgctcgagcaaactctt
actgttgttcttcagccggaaactacttctgtggaaacaaatatgcagccaagttggtcc
ctcagctccctctttgggcgaaaagtagttgggagttgtgttcttgcaaagtcaagtaat
gtgtatcttcaattggagggtcgtcttggtcacgaatcaaagaacgtagatacagaaata
gaagctcacaaactctggaagaatgcagattttgatttgtcccttaagccagatagggtt
cttcgagaaagcagcggcttgctctttatctttgatattgacaaatctagtgacagcgag
ccatttgatcttggccttaattggaaacttccctcaaaatggtcatgtcaacaagctcca
ttacaggctagtcggtttttgatgggaagtgggaacgaaaggggtgcaatagccatctta
ttaaaagcgacagaatcacaggagaagttacccggcagagaactcaccgatggacgctgt
acaataaaagcaaacattttccaaattttcccatggtatattaaggtttattaccatacc
ttacaaatttttgtggaccaacaacagaagacagacagtgaggtcttaaagaagatcaat
gtttcaccatctacggataaagtgtcatctggaatgttggagatgatgctggaactacca
tgtgaagttaaatctgctgccatatcaatcgaatatgataagggatttctacatatagat
gaatatcctcctgatgctaatcaaggattcgacattccatcggctctgataagcttcccc
agtcatcatgctagtttggatttccaagaagagctcagcaaatcacccttattatcaagt
tttaaggaaaaatccctagttcgctcctacacagaagtattgctcgtacctttgacaact
cctgattttagcatgccttacaatgtaatcacaatcacatgtaccatcttcgcattgtat
ttcggatcattgctcaatgttctacgtagacgaatcggtgaagaagaaaggtttctcaaa
agccaagcaggaaagaaaacaggtggagttaagcagttattattaagattgacagccaag
attagagggagaccaattgaagcaccatcatcagagtcgcctgcagctgaatcttcgttc
ttgtctactaaacttatcttcaaaatcatattaattgcaggagctgctgcagcatggcaa
tatttttccacggacaagtaa

DBGET integrated database retrieval system