KEGG   Camelina sativa (false flax): 104735206Help
Entry
104735206         CDS       T05044                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV6-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00052  Galactose metabolism
csat00500  Starch and sucrose metabolism
csat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104735206
   00500 Starch and sucrose metabolism
    104735206
Enzymes [BR:csat01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     104735206
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 104735206
NCBI-ProteinID: XP_010453254
Position
13
AA seq 552 aa AA seqDB search
MAEHGNVQDLLPNEVLNRTSFHFQPQRNWLNDPNAPMYYKGFYHLFYQYNPLAPEFSRKI
IWGHSVSQDMVNWIQLQPALFPSQSFDRNSCWSGSATILPDGKPVILYTGLDEPDRHQVT
VLAEPKDVSDPLLREWVKPKHNPVMLPPDDVPYYCFRDPTTAWQGQDGRWRVLIGAKHKD
TERGMAILYHSDDFIQWTSHPFPLLSSQVKEMWECLDFFPVSLTGKEGVETSVNNASVKH
VLKVSFEEKIGGKDCYVIGTYSSETEQFSADSEITNTSADLRYDYGMFYASKAFFDSAKN
RRINWGWVVETDSKEDHFQKGWAGLMSLPREMWVDRSGKRLMQWPIEEINHLRTRHVTSD
RRHFESGSRFEILGITAAQADVEVTFDLPVLEDNPQTLNSDKVEDKLLFNRDNSDGCLYG
PFGLLALVSQDLSEQTAIFFKIIRCGNGYAVIMGSDEQKSSLRDNVHKFTHGTFLDIDPR
HEMISLRCLVDHSIIESYGAGGRNVITSRVYPKLAIGEAAKLYVFNDGTKGVTMSSMEAW
SMRNAQINSNAI
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacatggaaacgtccaagatcttcttccaaacgaagtgcttaaccggacttct
ttccatttccaacctcagagaaattggctcaacgatccaaacgcgccaatgtattacaaa
ggattctaccatttgttctaccagtacaaccctttggcccctgagttcagtaggaagatc
atatggggacactctgtttcacaagacatggtcaactggatccaactgcaaccagccctt
tttccttctcagtcctttgaccgaaacagctgctggtcaggatccgccaccatcctccct
gatggcaaacctgtaattctgtacaccggactcgacgagcctgacagacatcaggttaca
gttcttgctgaacctaaggacgtttccgaccctttgcttcgtgagtgggtaaaaccaaag
cacaaccctgtgatgcttccgccagatgacgtcccctattactgcttccgtgaccctacg
accgcgtggcaagggcaagatgggagatggagagttctcataggagctaagcataaagat
actgaaagaggaatggcgattttgtaccacagtgatgattttatccaatggacaagtcat
ccgtttcctttactttcatcacaagtaaaggaaatgtgggaatgccttgattttttcccg
gtttcgctcactggtaaagaaggcgtagagacttcggtgaacaatgctagtgtgaagcat
gtcttgaaggtcagttttgaggaaaagattggaggcaaagattgttatgttattggtaca
tactcttccgagactgagcaattttctgcggattctgagatcaccaacaccagtgcggat
ttgagatatgattatggaatgttttacgcctcaaaagccttcttcgatagcgctaagaat
cggaggatcaactggggatgggttgtagagactgacagcaaagaagatcattttcagaaa
ggatgggctggccttatgtctctccccagggaaatgtgggtggacagaagtggaaagagg
ctgatgcaatggccaattgaagaaatcaaccatctcaggaccagacatgttacttctgat
agaaggcactttgaaagcggttcaagatttgagatcttaggcattactgctgcacaagcc
gacgtagaagtgacctttgaccttcctgttctggaagataatccccaaacactgaattct
gacaaagttgaagataagcttttgtttaatcgtgacaactctgatggatgtctttatggg
ccttttgggttgctagcattggtcagccaagatttatcggaacaaactgcaatcttcttc
aaaattattcgttgtggaaatggctatgcggttataatgggtagtgatgagcagaagtct
tcgttgagagacaacgtgcataaatttacgcatgggacatttctagacattgatccaaga
catgagatgatctcattaagatgtttggtcgaccactccatcatagagagctatggagca
ggaggaagaaatgtaataacatctagggtttatcccaaattggcaattggtgaagcagct
aagctctacgtgttcaatgatggaacaaagggtgtgaccatgtcatctatggaagcttgg
agcatgagaaatgcccaaatcaattcaaacgcaatttaa

DBGET integrated database retrieval system