KEGG   Camelina sativa (false flax): 104735209Help
Entry
104735209         CDS       T05044                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV6-like
Organism
csat  Camelina sativa (false flax)
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 104735209
NCBI-ProteinID: XP_019089844
Position
13
AA seq 234 aa AA seqDB search
MISRKDGLALWEMWLDTSGKRLIQWPIEEINHLRTKSVKLDSCEIKTGAPIVISGITAAQ
ADVEVTFNLPSLEDNPEILEADHVDDATLFDRDSSVGCVYGPFGLLALASHDLSEQTAIF
FKVIRRGNGYAVIMGSNEKRSSLRDGVKKSSHGTFVDINPRQEKISLRCLIDHSIIESYA
AGGKSVITSRVYPKLAIGEAAKLYVFNDGANGVIMTSLEAWSMRNAEINTNTTY
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaagaaaggatgggctggccttatgggaaatgtggctggacacaagtggaaag
aggctgatacaatggccaattgaggaaatcaaccatctccggaccaaaagtgttaaactc
gattcctgtgaaatcaaaaccggagcgcccattgtaatctctggcatcactgctgcccaa
gccgacgtggaagtgacttttaatctgccatcactggaagataaccccgaaatactggag
gctgatcatgttgatgatgcgactctgttcgatcgtgacagctctgttggatgcgtttac
gggccttttggattgctagcattggcttcccatgatttatctgaacaaaccgcaatcttt
tttaaagtcatccgacgtggaaacggatatgcagttataatgggcagcaacgagaagagg
tcttcgttgagagacggcgtaaaaaaatcttcgcatggaacattcgtagacattaatcca
aggcaggagaaaatctcattaagatgtttgatcgatcactcgattatagagagctacgca
gcaggaggaaaaagtgtgataacatcaagggtttatcccaaattggcaattggtgaagca
gctaagctttatgtgtttaatgatggagcaaatggtgtgatcatgacgtctctggaagct
tggagcatgagaaatgccgaaatcaatacaaacacaacttattaa

DBGET integrated database retrieval system