KEGG   Camelina sativa (false flax): 104735885Help
Entry
104735885         CDS       T05044                                 

Definition
(RefSeq) apyrase 2-like
  KO
K14641  apyrase [EC:3.6.1.5]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00230  Purine metabolism
csat00240  Pyrimidine metabolism
csat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104735885
   00240 Pyrimidine metabolism
    104735885
Enzymes [BR:csat01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     104735885
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDA1_CD39 Ppx-GppA
Motif
Other DBs
NCBI-GeneID: 104735885
NCBI-ProteinID: XP_010454056
Position
13
AA seq 473 aa AA seqDB search
MTAKRGGIGRHESIADKIQRHRGLVLVISVPIVLIALVLLLMPGRSTSDSVVEEYNVLNR
KGGPNSRGPKNYAVIFDAGSSGSRVHVYCFDQNLDLIPLGNELELFLQLKPGLSAYPTDP
RQAANSLVSLLDKAEASVPRELRPKTPVRVGATAGLRTLGHEASENILQAVRELLRDRSM
LKTEANAVTVLDGTQEGSYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAISEEDA
AKAPKPLEGEDSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSDDSDNPCVVTGYD
GKYKYGGKEFKGTASPSGASLDECRRITINSLKVNDTLCTHMKCTFGGVWNGGRGGGQKN
MFVASFFFDRAAEAGFVDPKQPVATVRPKDFEKAAKKACSMNLEEGKSKFPLVEEENLPY
LCMDLVYQYTLLIDGFGLEPSQTITLVKKVKYGEHAVEAAWPLGSAIEAVSSP
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgaagcgtggtggaattgggcggcacgaatctatcgctgacaagatccagcgc
caccgtggtcttgtgcttgtgatttcggttcccattgtgttgatcgctcttgttcttctg
ctaatgcctgggagatcgacttctgattccgtcgttgaggagtacaatgtgcttaatcgg
aaaggaggtcctaattcgagaggtccgaagaattacgctgtgatttttgatgctgggagt
tctggtagccgtgtacatgtttactgttttgatcagaacttggatcttatccctctcggc
aatgaacttgagctctttctacagctaaaaccagggttgagtgcgtatcctactgatccc
cggcaagcagcaaactctttggtctctcttcttgacaaagcagaagcttctgttcctcgc
gagttgcgtccaaagacacctgtcagagttggagcaacggcaggtttgaggacgctgggt
catgaagcatctgagaacattttgcaagcggttagggaactcttgagagatagaagcatg
ctgaaaactgaggcaaatgctgtaactgtactggatggtactcaggaaggttcttatcag
tgggtgacaattaactacttgctaaggaacttgggaaaaccatactcagatactgttgga
gtggttgatcttggaggggggtctgttcaaatggcatatgctatatctgaggaagatgct
gcaaaagcaccaaaaccattagaaggagaggattcatatgtcagagaaatgtacctgaag
ggacggaagtatttcctctatgttcacagttacctacattacggattactggctgcccga
gcagagattttgaaagtttctgacgattcagacaacccctgcgtcgtgacaggctatgat
ggtaagtacaagtatggaggaaaagaatttaaaggcactgcttcaccatctggtgcgagt
cttgatgagtgccgaaggataaccatcaactcactaaaagtgaatgatacactgtgtaca
cacatgaaatgcacattcggtggagtttggaatggtggtcgaggtggtggccaaaagaat
atgtttgttgcttcatttttctttgaccgtgctgctgaggctggatttgttgacccaaag
caaccggttgctacagttcgtcccaaggactttgagaaagcagcaaagaaagcttgtagt
atgaatctggaagagggaaaatcaaagttcccgcttgtggaggaagagaatttgccttac
ttgtgcatggatctcgtttaccaatacactctgctcattgatggattcggattggagcca
tctcagacaataacattagtgaaaaaggtaaaatacggagaacacgccgtggaagctgcg
tggccattaggtagcgccatcgaggccgtatcctcaccgtga

DBGET integrated database retrieval system