KEGG   Camelina sativa (false flax): 104736338Help
Entry
104736338         CDS       T05044                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit alpha-2, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00020  Citrate cycle (TCA cycle)
csat00640  Propanoate metabolism
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104736338
   00640 Propanoate metabolism
    104736338
Enzymes [BR:csat01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     104736338
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     104736338
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 104736338
NCBI-ProteinID: XP_010454606
Position
13
AA seq 346 aa AA seqDB search
MSRQVTRLLGSLRRCSGGGGSSELVVVPSCSSLTSLTQSRSFGTTHPPPAAVFVDKNTRV
ICQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVS
YVPAPFAAAAIMEGVAAELDLVVCITEGIPQHDMVRVKAALNSQSKTRLIGPNCPGIIKP
GECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD
CLEKFFVDPQTEGIILIGEIGGTAEEDAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAG
AIVSGGKGTAQDKIKSLRDAGVKVVESPAKIGAAMFEIFQERGLLK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtctaggcaggtgacgagacttctcggatctcttcgccgttgctccggcggtggcggg
agctcagagttggtggtggttccgtcatgcagctctctcacttcattgactcagtctcgc
tccttcggtacgactcatccgcctcctgcggctgtctttgtcgacaaaaacacacgtgtc
atctgccaaggtatcaccggaaagaacgggaccttccacactgaacaagccattgagtac
ggcaccaaaatggtagcaggagtgacaccaaagaaaggtggaacagaacatttaggtctg
cctgtttttaacacggttgctgaagctaaagctgagactaaagccaatgcctctgtgagt
tatgttcctgcgcctttcgctgctgctgctatcatggaaggtgttgctgctgagttagat
cttgttgtctgcattactgaaggcattcctcaacatgacatggttcgtgtaaaggctgct
cttaacagtcaatcaaaaactaggctgattggccctaattgtcctgggattatcaaacct
ggtgaatgcaagattgggatcatgcctggatacatccacaagcctgggaggatagggatt
gtttctcgatctggaactttgacatatgaagctgttttccaaactactgcagtaggtttg
gggcaatctacgtgtgtaggaattggtggggatccttttaacggcacaaattttgttgac
tgcttggagaagttcttcgtcgaccctcaaacagaaggtatcattctcattggagaaatc
ggtggtactgcagaagaagatgccgctgctttgataaaggaaagtggtacagacaagcct
gtagttgctttcattgctggacttactgcaccacccgggcgacgaatgggtcacgcggga
gccattgtttctggaggtaagggcacggctcaagacaagataaagagcttaagagacgct
ggagttaaggtggttgagtcaccggctaagattggcgcggcgatgtttgagattttccaa
gaaagaggtcttttgaagtga

DBGET integrated database retrieval system