KEGG   Camelina sativa (false flax): 104739457Help
Entry
104739457         CDS       T05044                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00260  Glycine, serine and threonine metabolism
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    104739457
Enzymes [BR:csat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     104739457
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_5 Pyridoxal_deC Aminotran_3 OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 104739457
NCBI-ProteinID: XP_010458106
Position
14
AA seq 358 aa AA seqDB search
MVMRSVDLRSDTVTRPTDAMREAMCGAEVDDDVLGYDPTARRLEDEMAKMMGKEAGLFVP
SGTMGNLISVMVHCDVRGSEVILGDNCHIHVYENGGISTIGGVHPKTIKNEEDGTMDLAA
IEAAIRDPKGSTFYPSTRLICLENTHANCGGRCLSVEYTERVGEIAKRHGVKLHIDGARL
FNASIALGVPVHKLVKAADSVSVCLSKGLGAPIGSVIVGSQSFIEKAKTVRKALGGGMRQ
IGVLWAAALVALQENLPKLQHDHKKAKLLAEGLNQMKGIRVNVTAVETNMIFMDMEDGSR
LTAEKLRRTLEENGILVIPENSSRIRMVIHHQITTSDVHYTLSCLQQAVQTIQEPSRN
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgagaagtgtagatctacgatcagataccgtgactagaccgaccgatgcgatg
agagaagcaatgtgtggcgctgaggtggatgatgacgtcctaggctacgacccaacggct
agacgtcttgaagatgagatggccaagatgatggggaaagaggcgggtctctttgtgcca
tccggtacaatgggaaatctgatcagcgtgatggttcactgcgatgtaagaggcagcgag
gtgattcttggagacaactgtcacatccatgtttacgagaatggagggatttcgaccatc
ggaggtgtgcatcccaagacgatcaagaatgaagaagacgggaccatggacttggccgct
atagaagcagccatcagagatcctaaaggaagcacgttttatccatcgacaaggttgatt
tgcttggagaacactcatgccaactgtggtgggagatgtttgagtgtggaatacactgag
agagttggagagattgcgaagagacatggtgtaaagctccatattgatggagcccgtctt
ttcaatgcttctatcgcacttggagttccagtccataagcttgtgaaggctgctgactct
gtttcggtgtgtctatctaaaggtcttggagctccaataggatctgtaattgttggttcg
caaagcttcatagagaaggcgaaaacagtaaggaaagcattaggtggaggaatgagacaa
attggcgttctttgggcagccgctttggttgcacttcaagagaacctcccaaagctacaa
catgaccacaagaaggccaagttgttagctgaagggttgaatcaaatgaaagggattaga
gtaaatgttacagccgtggagaccaacatgattttcatggatatggaggatggttcaaga
cttacagctgagaaactgcgcaggactctagaggagaatggcattctcgtcatcccggaa
aactcatcccggatcaggatggttatacaccaccagataacaacaagtgatgtgcattac
acattgtcttgcttacaacaagcagtgcagacgatacaagaaccaagccggaactaa

DBGET integrated database retrieval system