KEGG   Camelina sativa (false flax): 104739589Help
Entry
104739589         CDS       T05044                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00010  Glycolysis / Gluconeogenesis
csat00562  Inositol phosphate metabolism
csat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104739589
   00562 Inositol phosphate metabolism
    104739589
Enzymes [BR:csat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     104739589
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     104739589
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 104739589
NCBI-ProteinID: XP_010458300
Position
14
AA seq 488 aa AA seqDB search
MATKKTVWITLLCIFVVSQADQGFDVRHHLSTVTRYSVSKDVTQNLIQGSNVPSECTPIH
LNLVARHGTRSPTKKRLRELENLAGRLKELVRDAEARKLPLDKIPGWLGQWKSPWEGKVK
GGELIRQGEDELYQLGIRVRERFPSLFEDDYHPDVYTIRATQIPRASASAVAFGMGLFRE
KGNLGPGRNRAFAVTSENRASDTKLRFFECCQNYKSYRKAKEPAVDKLKEPVLNKITASV
AKRYGLSFTKEDVSSLWFLCKQEASLLNVTNQSCELFSPSEVALLEWTDDLEVFLLKGYG
NSLNYKMGVPLLEDVLNSMEEAIKAREEKLPPGSYEKARLRFAHAETIVPFSCLLGLFLH
GSEFEKIQKEQPLELPPQPPKTRDFRGSTMAPFGGNNILVLYSCPADSSPKYFVQVLHNE
HPIALPGCDGKDFCSLEDFKAKVVTPHLKHAFDNLCNANRDDPKQKPASSKLSILFGWLF
GSSQDTEL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgaagaagactgtttggatcacactgttgtgtatatttgttgtttcccaggcg
gatcagggtttcgatgttcgtcatcacctctccaccgtcaccagatactcagtttcgaaa
gatgttacccagaatttgattcaaggatccaatgtccccagtgagtgtacacctatccac
cttaaccttgtggctaggcatggaactcgttctccgaccaagaaacggttgcgggaactg
gagaatttggccggtaggttaaaggaactggtaagagatgcagaagctagaaaattgcct
ttagacaaaattcctggatggttaggacaatggaaatctccttgggaaggaaaagtgaaa
ggcggggagcttatcaggcaaggggaggacgagttgtaccaactgggaatccgagttagg
gaacggtttcctagtttgtttgaagatgattaccatcctgatgtctatacaataagagct
acgcagattcctcgggcatctgcaagtgctgtagcatttggaatggggttgttcagggaa
aaaggaaatctgggaccaggccgtaatagagcattcgctgtcacaagtgaaaaccgtgct
agtgatacaaagctgagattttttgaatgttgtcaaaactacaagagctatagaaaagct
aaggaacctgctgtggataagctcaaggaacctgttttgaataagattacagcttcagtt
gcaaagagatatggtctaagtttcactaaagaggacgtttcttctctctggtttctttgc
aagcaggaagcatcattgcttaatgtaactaatcaaagttgtgagcttttctcgccatca
gaggttgctttgctggaatggacagatgacttggaagtgtttctcctcaaaggttatggc
aattccttgaactacaaaatgggagttccattgctagaagatgttttgaattcaatggaa
gaagctatcaaggcccgggaagaaaagctgccgcctggaagttacgaaaaagcaaggctt
aggtttgcacatgccgaaacaatagttcccttttcttgtcttcttgggcttttccttcat
ggatctgagtttgagaaaatacagaaggaacaaccattggaactccctccacaacctcct
aaaaccagagattttagaggcagcaccatggctccgtttggtgggaacaacattcttgtc
ctctacagttgtcccgcagattcctctcccaaatacttcgttcaggttctgcacaacgag
catcctattgcacttccaggttgtgatggaaaagatttctgttctcttgaagatttcaag
gccaaagttgtaacccctcatctaaagcatgcttttgacaacctctgcaatgctaatcga
gatgacccgaaacagaagcctgcatcaagtaagttatcaatactgttcggttggctgttt
ggatcgagccaggataccgagctctag

DBGET integrated database retrieval system