KEGG   Camelina sativa (false flax): 104745477Help
Entry
104745477         CDS       T05044                                 

Definition
(RefSeq) probable mediator of RNA polymerase II transcription subunit 37c
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
csat  Camelina sativa (false flax)
Pathway
csat03040  Spliceosome
csat04141  Protein processing in endoplasmic reticulum
csat04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:csat00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    104745477
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104745477
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104745477
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:csat01009]
    104745477
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:csat03041]
    104745477
   03009 Ribosome biogenesis [BR:csat03009]
    104745477
   03110 Chaperones and folding catalysts [BR:csat03110]
    104745477
   04131 Membrane trafficking [BR:csat04131]
    104745477
   03051 Proteasome [BR:csat03051]
    104745477
   03029 Mitochondrial biogenesis [BR:csat03029]
    104745477
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csat04147]
    104745477
Protein phosphatases and associated proteins [BR:csat01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     104745477
Spliceosome [BR:csat03041]
 Complex B
  Other components
   Prp19 complex
    104745477
 Complex C
   Prp19-CDC5 complex
    104745477
Ribosome biogenesis [BR:csat03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    104745477
Chaperones and folding catalysts [BR:csat03110]
 Heat shock proteins
  HSP70 / DNAK
   104745477
Membrane trafficking [BR:csat04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    104745477
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    104745477
Proteasome [BR:csat03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    104745477
Mitochondrial biogenesis [BR:csat03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    104745477
Exosome [BR:csat04147]
 Exosomal proteins
  Proteins found in most exosomes
   104745477
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 104745477
NCBI-ProteinID: XP_010465032
Position
15
AA seq 650 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN
QVAMNPTNTVFDAKRLIGRRYSDPSVQSDLKHWPFTVKSGPAEKPMITVNYKGEEKQFSA
EEISSMVLIKMREIAEAFLGSPVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP
TAAAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY
TTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKK
KVDAKNALENYAYNMRNTIKDEKIASKLDAADKKKIEDAIDQAIEWLDGNQLAEADEFDD
KMKELESLCNPIIARMYQGAGPDMGGAGGMDEDAPAGGSGGAGPKIEEVD
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtaaaggtgaaggtccagctatcggtatcgatctcggtactacctactcttgc
gtcggtgtttggcaacacgaccgcgtcgaaatcatcgccaacgatcaaggcaaccgtacc
actccttcctacgttgctttcactgactccgagcgtctcatcggtgatgccgccaaaaat
caagtcgccatgaaccctaccaacaccgtcttcgatgctaaacgtctgattgggagaaga
tacagtgatccgtcggttcaatcggatttaaagcactggccattcacggttaaatccggt
ccagctgagaagcctatgatcacagtcaactacaagggagaggagaaacagttctctgcc
gaggagatctcttccatggttctcattaagatgcgggagattgctgaagctttccttggc
tctcctgttaagaacgctgttgttaccgtacctgcttatttcaacgactctcagcgtcag
gcgactaaggacgctggtgttatctctggtctcaacgtgatgcgtatcatcaacgagcca
accgctgctgcgattgcttacggtcttgataaaaaggcgtcgagtgttggcgagaagaat
gttttgatctttgatttgggaggtggtacttttgatgtttctttgcttacgattgaggaa
ggtatctttgaagtgaaggccacggctggtgacacgcatcttggtggtgaggacttcgac
aacaggatggttaatcattttgttcaggagtttaagaggaagaacaagaaggatatcact
ggtaacccgagagctttgaggaggcttaggacagcttgtgagagggctaagagaactctt
tcttctactgctcagacgactattgaaatcgactctttgtacgagggtattgatttctac
acaaccatcactcgtgctaggttcgaggagctcaacatggatttgtttaggaagtgtatg
gagccagtggagaagtgtttgagagatgctaagatggataagagcagtgttcatgatgtt
gtacttgttggtggctctacaagaatccctaaagtgcagcagttgttacaagactttttc
aatgggaaagagctctgtaaaagcattaacccggatgaagctgttgcttatggagctgct
gtccaagctgcgatcttgagcggggaagggaacgagaaggtccaagacttgttacttctt
gatgttactcctctgtccttgggtttggaaaccgccggtggggttatgactgttctgatt
ccgaggaacacaactattccgacgaagaaagagcagatcttctctacctattcagacaac
cagcctggtgttctgatccaagtctacgaaggggagagagcaaggacgaaggacaacaac
cttttgggaaagttcgagctcagcggtataccacctgctccacgaggtgttccccaaatt
acggtctgcttcgacattgacgccaatggtatcctaaacgtgtcggctgaggacaagacg
actggtcagaagaacaagatcacaatcacaaacgacaagggaaggctatcaaaggaagag
atcgagaagatggtacaggaagcagagaagtacaaggctgaggatgaagaacacaagaag
aaggttgatgcaaagaacgctctcgagaactatgcatacaacatgaggaacacgatcaag
gacgagaagatagcatctaagcttgatgcagctgacaagaagaagattgaagatgcgatc
gaccaagctattgaatggttggatggtaaccagctggcggaggcagatgagttcgacgat
aagatgaaggagctcgagtctctttgcaaccctatcattgctaggatgtaccaaggcgct
ggacctgatatgggtggtgctgggggaatggacgaagatgctcctgctggtggtagcggc
ggtgctggccccaagattgaagaagttgattaa

DBGET integrated database retrieval system