KEGG   Camelina sativa (false flax): 104747180Help
Entry
104747180         CDS       T05044                                 

Definition
(RefSeq) alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase-like
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00510  N-Glycan biosynthesis
csat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    104747180
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:csat01003]
    104747180
Enzymes [BR:csat01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     104747180
Glycosyltransferases [BR:csat01003]
 Glycan extension
  N-Glycan
   104747180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2
Motif
Other DBs
NCBI-GeneID: 104747180
NCBI-ProteinID: XP_010467066
Position
15
AA seq 431 aa AA seqDB search
MANLWKKQKLKDTGLCRLGILFAVTVSIVLMLVSVPRTALNRTSIGHDDLDDLDKDLEVK
LNASLLEVARGNGMSLRLHRRNQFTPRNLDLYPDLAKDRVVIVLYVHNRAQYFRVTVESL
SKVKGISETLLIVSHDGYFEEMNRIVEGIKFCQVKQIFSPYSPHVYRNSFPSVTPNDCIN
KGDEVKTHCDGNPDQYGNHRSPKIVSLKHHWWWMMNTVWDGLEETKRHEGHILFIEEDHF
LFPNAYRNIQTLTRLKPAKCPDCFAANLAPSDVKSRGEGLESLVAERMGNVGYSFNRSVW
ENIHQKAREFCYFDDYNWDITMWATVFPSFGSPVYTLRGPRTSAVHFGKCGLHQGKGDQG
DCIDNGVVNIEVKETDKVVNIKEEWGVRVYKHQAGYKAGFKGWGGWGDERDRHLCLDFAA
MYRSGSSSESP
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatctttggaagaagcagaaactgaaagatacgggtttgtgtcgtttagggatt
ctatttgcagttacagtctctatagttttgatgttggtgtctgtaccaagaactgctttg
aatagaacttccattggccatgatgatttggatgatttggacaaagatttggaagttaag
cttaatgcctcgttgctagaagtagctagaggtaatggaatgtctcttaggttgcataga
agaaaccagtttacgccgaggaatctggatctgtatccggatttggcaaaagaccgtgtg
gttatagtcttgtatgtgcacaatcgggctcagtattttcgagtaactgtggaaagtttg
tcaaaggttaaaggaattagtgagacattgttgattgttagccatgatggttactttgaa
gagatgaataggattgtggaaggtattaagttttgtcaggtgaaacagatattttcgccg
tattcgcctcatgtatatcgaaatagtttccccagtgtgaccccaaatgactgtataaac
aagggtgatgaggtgaagacacattgtgatggcaatcctgatcagtatgggaatcaccga
tctccaaagattgtatctttgaagcatcactggtggtggatgatgaacacggtttgggat
gggttggaggagactaaaagacatgagggtcatatccttttcattgaggaagatcacttt
ctgtttcctaatgcctaccgtaatatacagactctcacgaggctgaaacccgcaaaatgt
cctgactgctttgctgctaatttagcaccttctgatgtgaagtcaagaggagaagggctt
gaaagtttggttgcagagagaatgggaaatgttgggtattcgtttaatagaagtgtgtgg
gagaatatacaccagaaggcaagagagttttgttactttgatgattacaattgggatata
acgatgtgggcaactgttttcccctcatttggctcccctgtttacacgttgcgagggcct
aggactagtgctgtccactttggaaaatgtgggttgcatcaaggtaaaggagatcagggt
gactgcatcgataatggggtggtgaacattgaagttaaggaaacagataaagttgtaaac
ataaaagaagaatggggagttcgggtgtataagcatcaagcgggttataaagctggtttc
aaaggttggggaggttggggagatgaaagggaccgacatttatgtttggattttgccgct
atgtatcgttccggcagcagcagtgaatctccatga

DBGET integrated database retrieval system