KEGG   Camelina sativa (false flax): 104748858Help
Entry
104748858         CDS       T05044                                 

Definition
(RefSeq) geranylgeranyl pyrophosphate synthase 4
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00900  Terpenoid backbone biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
Module
csat_M00366  C10-C20 isoprenoid biosynthesis, plants
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    104748858
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:csat01006]
    104748858
Enzymes [BR:csat01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     104748858
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     104748858
    2.5.1.29  geranylgeranyl diphosphate synthase
     104748858
Prenyltransferases [BR:csat01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   104748858
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 104748858
NCBI-ProteinID: XP_019092381
Position
15
AA seq 232 aa AA seqDB search
LAIQAACAVEMIHTMSLIKDDLPCMDNDDLRRGKPTTHKVFGESVAILSGGALLALAFEH
LTEADVSSKKMVRAVKELAKSIGTKGLVAGQAKDLSSEGLDQNDVGLEDLEFIHVHKTGS
LLEASAVIGAVIGGGSEEEIEKVRSFARCIGLLFQVVDDILDETKSSEELGKTAGKDQIA
GKLTYPKVIGLEKSKEFVKKLKRDAREHLQGFDSDKVKPLIALTNFIANRNN
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
ttagcgattcaagcggcttgtgcggttgagatgattcacacaatgtcactcatcaaagat
gatcttccttgtatggacaatgacgatctccgacgaggtaaaccaactacacacaaagta
ttcggagaaagcgtggccatcctctccggcggcgcacttttagccctagctttcgagcat
ttgaccgaagctgacgtgtcatccaagaaaatggttagggccgttaaagaattggctaag
tctattggaacgaaaggactcgtggcgggacaagctaaggatttgagcagtgaagggttg
gatcaaaacgacgttggtttagaggatcttgagtttattcacgttcataaaaccggttcg
ttgctcgaagcgtcggcggttatcggagcggttattggtggtggttcagaggaagagatt
gagaaagtgagaagctttgcgaggtgtattggattgttgtttcaagtggttgatgatatt
ttggatgagactaagtcgtcggaggaattaggaaaaaccgccggaaaagatcagatcgcc
ggtaagctgacgtatccgaaagtgattggtctagagaaatcgaaggagtttgtgaagaag
ttgaagagagatgcgagagaacatcttcaagggtttgattcggacaaagtgaaacctttg
attgctcttaccaacttcattgccaacagaaacaactga

DBGET integrated database retrieval system