KEGG   Camelina sativa (false flax): 104749035Help
Entry
104749035         CDS       T05044                                 

Definition
(RefSeq) caffeoylshikimate esterase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00561  Glycerolipid metabolism
csat01100  Metabolic pathways
Module
csat_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    104749035
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:csat01002]
    104749035
Enzymes [BR:csat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     104749035
Peptidases [BR:csat01002]
 Serine Peptidases
  Family S33
   104749035
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Peptidase_S9 Abhydrolase_6 AXE1 Esterase Abhydrolase_3 FSH1 SPG48
Motif
Other DBs
NCBI-GeneID: 104749035
NCBI-ProteinID: XP_010468913
Position
16
AA seq 352 aa AA seqDB search
MTKLRFEYEYEEEYIKNSRGVELYACRWVPSSSPRALVFLCHGYAMECSSFMRECGIRLT
SAGYAVFGMDYEGHGRSKGARCYIKKFSNIVNDCYDYYTFISAQEKYKQKGRFLYGESMG
GAVALLLHKKDPSFWNGALLVAPMCKISEKVKPHPVVINLLTRVEDIIPKWKIVPTKDVI
DSAFKDPVKREEIRNNKLIYQDKPRLKTALEMLRTSMDLEETLHEITLPFFVLHGEADIV
TDPEISKALFEKASTRDKTIKLYPGMWHGLTSGEPDANVDLVFADMVNWLDVRTGDSASL
TVTPIQEDRTCNVIKVVSNGQEKSERPQQASSSLLCGLNGGGGRRLVHRSSM
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagctgagattcgaatacgaatacgaggaggaatacattaaaaactcgagaggt
gtcgagttgtacgcttgcagatgggttccatcttcttctcctcgagctttggtctttctc
tgccatggttacgctatggagtgcagtagcttcatgagagaatgcggaatacggttgaca
tcggcggggtacgcggtgtttggtatggactacgaaggacatggccggtccaagggagct
cgttgctatatcaaaaagttcagtaatatagtaaatgactgctacgactattacaccttc
atctctgcacaagaaaaatacaaacagaaaggtaggtttttgtatggagaatcaatggga
ggtgcggttgctttgttgcttcacaagaaagatccttctttttggaacggtgcccttctc
gttgctcccatgtgtaagatatcagagaaggtgaaaccacacccagtggtcataaatcta
ctaacaagagttgaagatattataccaaaatggaagatcgttccaacaaaagatgttatc
gattctgctttcaaggatccggtcaagcgggaagagataaggaacaacaagctgatatat
caagacaagccaaggcttaaaacggcactcgaaatgcttagaacgagcatggacctcgaa
gaaaccctacacgagatcacattgcctttctttgtcctccacggtgaagcagacattgtg
actgatccagagataagcaaagccttgttcgagaaagcaagcacacgtgacaaaaccatc
aagctttacccaggcatgtggcatgggttaacttctggtgagcctgacgcgaacgttgac
ctcgtttttgctgacatggtgaattggcttgacgtacgtacgggagactccgcttctctc
actgtcactcccatacaagaagatcgtacctgcaatgttattaaagtcgtaagtaacggt
caagagaaatctgaacgaccacaacaagctagtagtagtctcctttgtgggttaaacggt
ggtggtggacgccgtttggttcatcgatcttctatgtaa

DBGET integrated database retrieval system