KEGG   Camelina sativa (false flax): 104749502Help
Entry
104749502         CDS       T05044                                 

Definition
(RefSeq) protein S-acyltransferase 21
  KO
K20027  palmitoyltransferase ZDHHC1/11 [EC:2.3.1.225]
Organism
csat  Camelina sativa (false flax)
Brite
KEGG Orthology (KO) [BR:csat00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csat04131]
    104749502
Enzymes [BR:csat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     104749502
Membrane trafficking [BR:csat04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    104749502
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 104749502
NCBI-ProteinID: XP_010469446
Position
16
AA seq 569 aa AA seqDB search
MARRHGWQLPAHTFQVVAITVFFLLTIAYYAFFAPFLWNKLYEYIAIGVYSFLAFSVLVL
YIRCTGIDPADPGIFLRTDNTPAHKSQNSNYVPDNASAIDGGPYIRHGSGCCNVVGRFIC
GCLVIQDCRRDTQQEQSNEPEEALFCSLCNAEVRMFSKHCRSCGKCVDGFDHHCRWLNNC
VGHKNYISFVCLMAASFLWLIAEFGVGVAVFVRCFVDQNAMEHLITEKLGLGFSRPPFAA
VVVVCTTLSLLALIPLGELLFFHIILIRKGITTYEYVVALRAQTEPLGPSVDELDQTSQV
PSPTSSAVTAASGRSSLGMSIQYRGASLCTPPNIFMDQQDDVIQHLEPGPVRSTIDPETL
SQKKPLQRQQVRINPWKLAKLDSKEASKAAAKARASSSVLLPVSSRQNLYKTSSNVSGRS
SPASSHHARKGKADSESCSISSPGLTRDHFNPMYMSSPANESPLNEEEESRNAVVAARRN
LPPSDESSVVWDPEAGRFVSSSRIPGTDFGGPLGNERVNTITGSGTEGSRRSRVNPLTGY
FQQVRSQRGDQLPVFMPTDSQLHRHLSTS
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atggcgagaagacatggatggcaacttccagctcacacatttcaggttgttgctatcact
gtatttttcttgctgactatcgcttactatgccttctttgctccgtttctttggaacaaa
ctctatgaatatattgccattggtgtttactctttcctggcgttttcggttttagttctg
tacatccgatgcactggcatagatcctgcagatcctggaatctttttaaggactgataac
actccagcacataagtcacagaacagtaactacgttcctgataatgcctcagctattgat
ggtgggccatatattagacacggctcaggttgctgtaatgtggtaggaagattcatttgt
ggttgtttagtaatacaagattgccgtagagatacccaacaagagcaatcaaacgaacca
gaagaagctctgttctgctcattgtgtaatgctgaggtacgtatgtttagcaagcactgt
cgaagttgtggcaagtgtgtcgatgggtttgatcatcattgccgatggctaaataactgt
gtggggcataaaaactacatcagctttgtgtgtcttatggcggcaagctttttatggctt
atagctgaatttggagttggtgttgctgtatttgttcgatgtttcgtggaccaaaatgca
atggaacatcttataactgaaaagcttgggcttggtttctcccgtcctccatttgcagct
gttgtggttgtttgtacaactctctcgttacttgctttgatacctcttggggaactttta
tttttccatattattttgatccgaaagggaatcacaacatatgaatatgttgttgccctg
agagcgcaaactgaaccacttggaccatctgtagatgagctagaccaaacgagccaggtt
ccttcacctacaagctcagctgtgacagccgcgagtggtagaagctctctcggaatgagc
attcaataccgcggtgcctccttgtgtacacctccaaacatattcatggatcaacaggac
gatgttatccagcatttggagcctggacctgtacgatccaccatagatcccgagacactt
tcacagaagaagccacttcagcgtcaacaagtaaggatcaatccatggaagctggcgaaa
ctcgactcaaaagaagcatctaaagcagctgcaaaagcgcgtgcatcttcatcagtactt
cttccagtaagttcacggcaaaacctttacaaaaccagcagcaatgtaagcgggagaagc
agccccgcaagttcccatcacgctagaaaaggcaaagctgattcagagtcttgtagcatt
agtagtccaggtttgacgagagatcacttcaacccaatgtacatgtcatcaccagctaac
gagtcaccattaaatgaggaagaagaaagcagaaatgctgttgttgcagctagaagaaac
ttgcctccaagcgatgagagttcagtcgtttgggatcctgaagctggccggtttgtatcg
tcgtctaggattccaggaacagattttggaggtcctcttggtaatgaacgtgtaaacacc
ataacaggttctgggactgaaggtagcagaaggagtagagtaaaccctttgactggttat
ttccaacaagtaagatcacagagaggagaccaacttccagtgtttatgcctactgattct
caattgcacagacatttatctactagctag

DBGET integrated database retrieval system