KEGG   Camelina sativa (false flax): 104750557Help
Entry
104750557         CDS       T05044                                 

Definition
(RefSeq) cyclin-dependent kinase G-2
  KO
K08818  cell division cycle 2-like [EC:2.7.11.22]
Organism
csat  Camelina sativa (false flax)
Brite
KEGG Orthology (KO) [BR:csat00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csat01001]
    104750557
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:csat03041]
    104750557
Enzymes [BR:csat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     104750557
Protein kinases [BR:csat01001]
 Serine/threonine kinases: CMGC group
  CDK family
   104750557
Spliceosome [BR:csat03041]
 Complex A
  Other components
   Complex A specific factors
    104750557
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Kdo RIO1 Arg_decarbox_C
Motif
Other DBs
NCBI-GeneID: 104750557
NCBI-ProteinID: XP_010470669
Position
16
AA seq 742 aa AA seqDB search
MAAGRSVRYPDHELRDQESNSRFSRRDSTYSNEDYDHVRNGALDNEKGRVSNQRHGDSGK
DRDMIRSGARQKERGMVNSGSRLSKSNPGIREVFMDRGPKRCGFSARSVDREPGELSSES
GSDDLIESESLVKNNGVVKQVENTAQSPVEKKRKFSPIVWDRDDHERSNLSRHDKPVEVT
PPPPPPPLIKSSSQSKSNMHQDPVQVSDSTVSVPALSPSVEMSSLCMVEQSSNAGQDCKQ
EDAAHLEEEENMPTRHISSSRWAAGNSSPTDEGEVVEEVGANKRRKNPFPAQGRLRNKSQ
TPEVGELVREGYRSSDSDERGHHSLPRSRDDFKEKDAVKGDKMDIDEEEHSRGNSSYSLS
ETDSDDEYVRHETPEPAGIPLRSINMLQGCRSVDEFERLNKIDEGTYGVVYRAKDKKTGD
IVALKKVKMEKEREGFPLTSLREINILLSFHHPSIVDVKEVVVGSSLDSIFMVMEYMEHD
LKALMESMKQRFSQSEVKCLMLQLLEGVKYLHDNWVLHRDLKTSNLLLNNRGELKICDFG
LARQYGSPLKPYTHLVVTLWYRAPELLLGAKQYSTAIDMWSLGCIMAELLSKAPLFNGKT
EFDQLDKIFRILGTPNEAIWPGFSKLPGVKVNFVKHQYNLLRKKFPATSFTGAPVLSDAG
FDLLNKLLTYDPERRITVDEALKHDWFREVPLPKSKDFMPTFPAQHAQDRRGRRMVKSPD
PLEEQRRKELTQAELGSGGLFG
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgggaggagtgtaagatatcctgaccatgaactgagagaccaggagtcgaat
tctagattctccaggcgggatagtacttactccaatgaggattatgaccatgttaggaac
ggtgctcttgataatgaaaagggacgggttagtaatcaaagacacggggatagcggtaaa
gatagagatatgattaggtccggagctagacagaaagagagaggaatggttaatagtggg
tctcggttatcgaagagcaatccaggtattagggaagtctttatggatcgtggtcctaaa
agatgtgggttttcagctaggtctgtggatagggaaccaggtgagctctctagtgagagt
gggtcggatgatttgattgaatctgagtcactggtgaaaaataacggtgttgtgaagcag
gtagagaatacagctcaaagccctgtagaaaagaagagaaagttttcaccaatagtatgg
gacagagatgaccatgaaagaagtaatttgagcagacatgataaacctgttgaggtcact
cctcctcctcccccaccaccactaatcaagagctcaagccagtcaaagagtaacatgcat
caagatcctgtgcaagttagtgattctacggtttctgtgcctgctttatcaccttcggta
gagatgtcctctttgtgtatggtagaacaatcatcaaatgctgggcaggactgcaaacaa
gaggatgcagcacacctggaagaggaggaaaacatgccaaccaggcatatatcatcctct
aggtgggcagctggcaacagttctccaactgatgaaggtgaagtagtagaagaagtggga
gcaaacaaaaggaggaagaatccctttccagcgcaggggagattgcgcaataagtctcaa
acacctgaggtcggggagttagtgagagaaggttatagatcatctgattccgatgaaagg
gggcaccattctttgccaagaagcagagatgattttaaggagaaggatgctgttaagggt
gacaagatggatatagatgaggaggaacacagtagaggaaactctagttacagccttagt
gaaacagattcggatgatgaatatgttcgacatgagacacctgaacctgccggtatccca
ctgagaagtataaacatgctccagggttgtagaagtgttgatgaatttgagagattaaat
aagatagatgaaggtacttatggtgttgtttatagagcaaaggataagaagacaggcgat
atagtggcattgaagaaggtgaaaatggaaaaagaaagagaaggctttccattgacttct
ctaagggagattaatatacttctttcgtttcatcatccatcaatagtggatgttaaagag
gtggtcgtgggtagtagtcttgatagcatttttatggtgatggaatacatggagcatgat
cttaaagcattgatggagtcaatgaagcagcgtttcagtcagagtgaagttaaatgctta
atgcttcaacttttagagggcgtcaagtatcttcacgacaactgggtgcttcatcgagat
ttgaaaacatctaatctgcttttaaacaatcggggtgagttgaagatatgtgactttggt
ttggctcggcaatatggcagcccgctgaagccgtatactcatctggttgttacgctttgg
tacagggcacctgaacttctcttgggagccaaacaatattctacggccattgacatgtgg
tcactgggctgtatcatggcagaactattatcgaaggcgccattgttcaatgggaaaacg
gagtttgatcaacttgacaagattttcagaatccttggtactcccaatgaagccatttgg
cctgggttctccaagctgcctggagtcaaggtcaactttgtcaagcatcagtataaccta
ttacgtaagaaattcccagccacttcattcactggcgccccagttctgtccgatgctggg
tttgacctgctgaacaagctcctaacgtatgatcctgagaggagaataactgttgatgaa
gctctaaagcatgattggttccgtgaagtccctctgccaaaatcgaaagattttatgcct
actttccctgctcaacatgcccaagacaggcgtgggaggagaatggtaaagagccctgat
cctttggaagagcaacgtaggaaggaattaacacaagctgaacttgggtctggtggtctg
tttggctga

DBGET integrated database retrieval system