KEGG   Camelina sativa (false flax): 104751958Help
Entry
104751958         CDS       T05044                                 

Definition
(RefSeq) putative terpenoid synthase 5
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    104751958
Enzymes [BR:csat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     104751958
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth Vsr Peptidase_M26_N
Motif
Other DBs
NCBI-GeneID: 104751958
NCBI-ProteinID: XP_010472322
Position
16
AA seq 634 aa AA seqDB search
MLYVVHRLCMYINISDSINNVAKLLTCDTSNKVFTMETFTLFGTQVSLLSPNVVSKLSRF
PLTSFARKHTKQFCLKTRECELHESTRTFKKLPPSHWGDHFLHLPINVSDMDTLTKEMNV
LKPTVRKMLMYSQDAEETKKRILLIYKLVALGLAYHFEDEIDDNLKHSFGKIETNMAGEI
DLSTVSVMFWVFRTYGYNLSSDVFKRFKGKDGKFEECLIEDVKGLLSLYEASQLGTSTED
ILDEAMSFASSHLEYLAGGTCPPHISRLIQNALYMPQHHNAEILFASEYIWFYGQEDVHN
KVLLELAKLNFKFLQLHWIHELKTLTKWWNDQDLTSKLPPYFRDRMVECHLYGVIMYFEP
QYSFGRITLAKFLVLLTVVDDTCDRYGSVPEVAKLLDCVERWDPDFGESLPDYLKTVFKF
TLDVFEDCERAGKCEQGRSFNVEGALKEFKILQRSHLNYAEWAKTEKVPTFEEYLEVGGV
GVTMYATLAMGFLGLGPRAREQGYEWLNSRPKLVHDLATKGRLMNDKTGFKDDMGRGFIA
NAVNYYMKEHGATEEETYTDFHKLVRDLEKSVNSEFLKINKGVPREILSRAINCGKMMDV
TYRSDDGYTRPKGKFTEYVASLFVDHMDASLKIN
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgctctacgtcgttcatagactttgtatgtatataaatatctccgattctatcaacaat
gtagctaaacttttgacgtgtgacactagcaacaaagtatttaccatggaaaccttcacc
ctttttggaactcaagtctctcttctttctccgaatgtggtgagcaaactctctcgcttt
ccactgacatcatttgctcgtaagcatacaaagcagttttgtttgaagactagggagtgt
gagcttcatgaaagtacgcgtacgtttaagaagttgccaccttctcattggggtgatcat
ttccttcatcttcccatcaatgtctcagatatggatacgcttacaaaagagatgaacgta
ctaaagcctaccgtaaggaagatgctcatgtattcacaagacgcggaggagacaaagaag
aggattcttctaatctataagttggtcgcacttggtctggcataccacttcgaagatgag
atagatgataatctgaaacacagcttcggaaagatagagaccaatatggccggtgaaatt
gacttgtccacagtttcggtcatgttttgggttttcaggacatatggatataacttgtct
tcagacgtgtttaagagatttaaagggaaggatgggaagtttgaagaatgtcttatagaa
gatgtcaaaggtctgctaagtttgtatgaagcctcgcaattgggtacgagcactgaggat
attttggacgaagcgatgagctttgcgtcgagccacttggagtatttagcaggtggaacg
tgtccgcctcatatctctaggcttatacaaaatgcgctttacatgccacagcaccacaat
gctgaaatattattcgcaagcgagtacatttggttctatggccaagaagatgttcacaac
aaagtcctactcgagttagccaagctcaatttcaagttccttcaactccactggattcac
gagctgaaaactctcaccaaatggtggaatgaccaagatcttacatctaagctcccacct
tactttagagacagaatggtggagtgccatttatatggagtgattatgtatttcgagcca
caatattcatttggtagaatcacattggctaagttcttggtgctgttgaccgttgtcgat
gacacgtgtgatagatacggttctgttcctgaagttgcaaagcttcttgattgcgtcgaa
agatgggatccagattttggggagagtctgccagattatctgaaaaccgtcttcaagttt
actttggacgtttttgaagattgtgaacgagcggggaagtgtgaacaaggacgaagcttc
aatgtggaaggtgcattaaaagagttcaagatactccagcgatcccaccttaactatgca
gagtgggcaaagacagaaaaggtgccaacatttgaagaatatttggaggttgggggcgtg
ggggtcacaatgtatgcaactttagcaatgggatttctcgggttgggaccgagggctagg
gaacaaggctatgagtggctaaactctagaccaaaactcgttcatgatttggcaacaaag
ggtcgtctgatgaatgacaagactggcttcaaggatgacatggggagaggttttatcgca
aacgcagtcaactattatatgaaggaacacggagctaccgaagaggaaacatatacggat
tttcataaattagttagagacctggagaagtcggtgaactcggagttcttgaagataaat
aaaggagtccctcgcgagatcctttctcgagccattaactgtgggaaaatgatggatgtt
acctacagatccgatgatgggtacactcggcccaaaggaaaattcacagagtatgtcgca
tcattgtttgtcgaccacatggatgcatctttgaagataaattaa

DBGET integrated database retrieval system