KEGG   Camelina sativa (false flax): 104752216Help
Entry
104752216         CDS       T05044                                 

Definition
(RefSeq) biotin--protein ligase 1, chloroplastic isoform X1
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00780  Biotin metabolism
csat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    104752216
Enzymes [BR:csat01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     104752216
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     104752216
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     104752216
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     104752216
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_LplA_LipB BPL_C BPL_LplA_LipB_2
Motif
Other DBs
NCBI-GeneID: 104752216
NCBI-ProteinID: XP_010472598
Position
16
AA seq 332 aa AA seqDB search
MESHHASCSLVLCGKSSVETEIAKRLKNNNNSLKLPDNTKVSLFLESEAKHVVKDDDGDS
FDLSLFMNSILTHQFGRFLIWSPRLSSTHDVVSHNFSELPVGSVCVTDVQLKGRGRTKNV
WESPKGCLMYSFTLEMEDGRVVPLVQYVVSLAVTEAVNHVCDKKGFPYIDVKIKWPNDLY
LNGLKVGGILCTSTYRSKKFHVSVGVGLNVDNEQPTTCLNAALKDMSPASNLLKREEILG
AFFHQFEKFFDLFMDQGFKSLEELYYRTWLHSEQRVIVEEKVQDQVVQNVVTIQGLTSSG
YLLAIGDDNQMYELHPDGNSFDFFKGLVRRKI
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggagagtcatcatgcttcttgtagcttggttctatgtggcaagtcctctgtggaaact
gagatagcaaagcgtctcaagaacaacaacaactcgcttaaactcccagacaataccaaa
gtttcactctttttagaatccgaggctaagcatgtggtcaaagatgatgatggtgattcc
ttcgatctctcactctttatgaactccattctaactcatcagtttgggaggtttctcatt
tggtctccccgcttgtcgtccactcacgatgttgtttctcataacttctctgagcttcca
gttggttcagtttgtgtcactgatgtccagcttaaaggtcgaggcagaactaagaatgta
tgggaatctccaaagggttgtcttatgtattcttttactctagaaatggaagatggtcgt
gtcgtgcctttggtacagtatgtggtatctcttgctgtaaccgaagcagtgaatcatgtc
tgtgacaagaaaggttttccgtacattgatgttaaaattaagtggccgaatgatctctac
ttgaatggccttaaggttggaggcattttgtgtacctcgacttatagatcaaagaagttt
catgtcagtgtcggtgtgggattgaatgtggacaacgagcaaccaaccacatgcttaaat
gctgcactaaaagacatgtctcctgcgtcaaacttgctcaaaagagaagaaatccttgga
gctttttttcatcaatttgaaaaattctttgatctattcatggaccaaggttttaaatct
ctcgaggagctttactacagaacatggttacacagtgagcaaagagtgattgttgaagaa
aaagtacaggaccaagttgttcaaaatgttgttactatccagggattgacgtcttcggga
tatttgctggctattggagatgacaatcaaatgtatgagcttcaccctgatggcaatagt
tttgactttttcaaaggtctggttcgaagaaaaatataa

DBGET integrated database retrieval system