KEGG   Camelina sativa (false flax): 104752387Help
Entry
104752387         CDS       T05044                                 

Definition
(RefSeq) 2-dehydro-3-deoxyphosphooctonate aldolase 1
  KO
K01627  2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase) [EC:2.5.1.55]
Organism
csat  Camelina sativa (false flax)
Pathway
csat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csat00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:csat01005]
    104752387
Enzymes [BR:csat01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.55  3-deoxy-8-phosphooctulonate synthase
     104752387
Lipopolysaccharide biosynthesis proteins [BR:csat01005]
 Unusual sugar
  104752387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-GeneID: 104752387
NCBI-ProteinID: XP_019083546
Position
7
AA seq 290 aa AA seqDB search
MAASSPLYNQLKAAEPFFLLAGPNVIESEEHILRMAKHIKDIATKVGLPLVFKSSFDKAN
RTSSKSFRGPGMAEGLKILEKVKVAYDLPIVTDVHESSQCEAVGKVADIIQIPAFLCRQT
DLLVAAAQTGKIINIKKGQFCAPSVMENSAEKIRLAGNPNVMVCERGTMFGYNDLIVDPR
NFEWMREANCPVVADITHSLQQPAGKKLDGGGVASGGLRELIPCIARTAVAVGVDGIFME
VHDDPLSAPVDGPTQWPLRHLEELLEELIAIARVTKGKQRFQIDLTPYHD
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggcggcatcatcaccattgtacaatcaactcaaggctgctgaaccattctttttgttg
gctggtccaaatgtgatcgaatccgaggaacatattcttcgaatggcaaaacacatcaaa
gacattgccacaaaagttgggttgccccttgttttcaagtcaagttttgataaagctaac
agaacttcttcaaagtcattccgaggtcctggcatggcggagggtctgaagattcttgag
aaggtgaaagttgcatatgacctaccaatagtaactgatgttcacgaatcaagccagtgt
gaagcagtcggcaaggttgcagatataattcagattccagcattcttatgtcgccagaca
gatcttctggttgcagcagcacaaactgggaaaattatcaatattaagaaaggacaattc
tgtgctccttctgtcatggaaaattcagccgagaagatcagactggctgggaatccaaat
gtgatggtttgtgaaagaggaaccatgtttggatacaatgatttgatagtagatccaaga
aactttgagtggatgagggaagctaattgtcctgttgtcgctgatataacccattcacta
caacaacctgcaggcaagaagttggatggtggtggtgttgctagtggaggccttcgcgag
ttaataccatgcattgcaagaacagctgtagcagttggcgtcgatggaattttcatggag
gttcatgatgatcctctaagtgctccagttgatggtccaactcaatggcctttgcgtcat
ctagaagaactcctggaagagctcatcgcgattgctagggtcacaaaagggaaacagcgt
ttccaaatcgatctcacaccctaccatgattaa

DBGET integrated database retrieval system