KEGG   Camelina sativa (false flax): 104752773Help
Entry
104752773         CDS       T05044                                 

Definition
(RefSeq) lactosylceramide 4-alpha-galactosyltransferase-like
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00601  Glycosphingolipid biosynthesis - lacto and neolacto series
csat00603  Glycosphingolipid biosynthesis - globo and isoglobo series
csat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    104752773
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    104752773
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:csat01003]
    104752773
Enzymes [BR:csat01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     104752773
Glycosyltransferases [BR:csat01003]
 Glycan extension
  P blood group
   104752773
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth TcdA_TcdB
Motif
Other DBs
NCBI-GeneID: 104752773
NCBI-ProteinID: XP_010473307
Position
16
AA seq 441 aa AA seqDB search
MEQSKRTEQVVLSQRLKRFIVSFVCCLPMSLLGLLLMLLLIYNSFSVFSFHLDTIPPVKA
TLSPIQHQILHHHASTSLSEADSSLLLVVKETSLGFVQRQNDSSTRTERRKRRFKRRIDS
TSAITQRLQVKPRQRFKTRVKSFLSKSSCESLFFMTWISSIESFGDRERFTIESLFKFHP
NSCLILVSNSFDCDRGTLILKPFIDKGLKVLPIKPDFAYIFKDTSAEKWFERLKKGTLSP
GGIPLEQNLSNLLRLVLLYKYGGIYIDTDVIILKPLTDLHNVIGAQAVDAVTRKWSRLNN
AVLIFDKNHPLLKRFIDEFSRTFNGNKWGHNGPYLVSRVIARINISPSSDLGFSVLPPSA
FYPVDWNRIKGFYRAPTNETDAIWLRKRLAHLRKNTFAVHLWNRESKKLRIEEGSIIHQL
MSHSCIFCNSSSLHFNLEHVK
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggaacagagcaaaagaacagaacaagttgtgttatcgcagagattaaaaagatttatc
gtctcctttgtttgttgtcttcccatgtctcttctcggtctccttctcatgcttctctta
atctacaacagcttctctgtcttctcttttcatcttgatacaatcccacctgttaaagcc
actctatcaccaattcaacaccagattcttcatcatcatgcatcaacatcattatctgag
gcagactcttcattgttgcttgtggtgaaagaaacctctttaggtttcgtacagaggcag
aatgattcgtcgacgaggacggagagaaggaaaaggagattcaagagaagaatcgattca
acttctgcgataacacagcgtttacaagtcaaaccaagacagagattcaagacgagggtc
aagtctttcttgtccaaatcttcttgcgagtcactcttcttcatgacctggatctcctcc
attgagtcttttggtgatcgagagcgattcaccatagagagcctcttcaagtttcaccca
aacagctgtttgatcttggtctcaaactcatttgactgtgacagaggaaccctaatcttg
aaaccctttatagataaagggcttaaagtgcttccaattaaacctgacttcgcttacatc
ttcaaagatacatcagcagagaaatggtttgaaagattgaagaaaggaacattgagtcca
ggagggattccattagagcaaaacctctccaacctgctgagattagtcctgctctacaaa
tacggtggaatctacatagacacagacgttataatcctcaaacctcttaccgatctccac
aacgtaatcggagcacaagcagttgatgcagtcacaagaaaatggagcaggctcaacaac
gcggtactcatcttcgacaaaaaccatcctttgcttaagagattcattgacgagttctcg
agaaccttcaacggtaacaaatggggacacaacggtccatacttagtctcgagggtcata
gcaagaatcaacatctccccatcttcagatttgggattctctgttcttccaccatctgct
ttttatccggtggattggaatagaatcaaaggattctacagagcgcccacgaatgagacc
gatgctatttggttgcggaagaggcttgcgcacttacgtaaaaatacatttgctgttcat
ctttggaacagagagagtaagaaacttaggattgaagaaggaagtattattcatcaactc
atgtctcattcttgcatcttttgtaactcttcttctttacattttaacttagaacatgta
aagtaa

DBGET integrated database retrieval system