KEGG   Camelina sativa (false flax): 104753172Help
Entry
104753172         CDS       T05044                                 

Definition
(RefSeq) beta-glucosidase 10-like
Organism
csat  Camelina sativa (false flax)
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-GeneID: 104753172
NCBI-ProteinID: XP_019093188
Position
16
AA seq 510 aa AA seqDB search
MKPFSLFFSFLVVAIVLATTSYSIDAFTRNDFPEDFLSGAATSAYQWEGAVDEDGRTPSV
WDTFTHSHSRDNGDIACDGYHKYKEDVKLMADMGLEAFRFSISWSRLIPNGRGPINQKGL
LFYKNFIKELRNHGIEPHVTLYHYDLPRSLEDEYGGWINRKIIEDFTAFADVCFREFGED
VKLWTTINEATIFAICAYGEGISPPGHCSPNKYINCSTGNSSTEPYIAGHNMLLAHASAS
KLYKLKYKSKERGSVGFSIFAFGLSPDTNSKDDEIATQRAKAFLFGWMLKPLVFGDYPDE
MKRTLGLRLPVFSEEESEQVKGSSDFIGIIHYITFYVTNQPAPSIFPSMNDGFFKDMGAY
LIPIGNFSFSEWEAIPWGLEGVLEYLKQSYNNPPIYILENGKPMIHDSMLQDTPRVVYIQ
AYIGVVLNAVKNGSDTRGYFVWSMIDVYELMAGYRTSFGMYYVNFSDPGRNRSPKLSASW
YTAFLNGTIDVASQDSMIQLQRNLSGFSLL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctttttctctgttttttagttttctagtagtggccatcgttttggcaacaaca
agctacagtattgatgccttcaccagaaacgattttccagaggatttcctatccggagcc
gccacttctgcttatcagtgggaaggagctgttgatgaagatggaagaactcctagcgtc
tgggatactttcacccactctcatagtagagataatggagacatagcatgtgatggttat
cacaaatataaggaagatgttaagctcatggcagatatgggcttagaagcattcagattc
tctatctcctggtcaagacttatacctaatggaagaggacccattaaccaaaaaggtcta
ttgttttacaagaacttcatcaaagaattacgaaatcatggaatcgagccacacgttaca
ctttaccactatgatcttcctcggtctcttgaagatgagtacggaggatggatcaaccga
aaaatcatagaagacttcactgcttttgcagatgtttgcttcagagagtttggggaggat
gtgaagttatggactacaatcaacgaagctacgatattcgccatttgtgcttatggcgaa
ggaatctcgccgcctggacattgttctcctaacaaatacatcaattgctctactggaaat
tcttctacagaaccatatattgcaggccataacatgttgctagctcatgcctccgcttcc
aagttgtataaactaaagtacaagagtaaggagagaggatccgtaggctttagtatattt
gcattcgggttatctcctgatacaaactccaaggacgatgaaatcgcaactcaaagagct
aaagctttcctctttggctggatgttgaagcctttggtatttggggactatccggatgaa
atgaagagaaccttggggttgaggttacctgttttctcagaggaagagtcggagcaagtg
aaaggatcatctgactttattggaattattcactacataacattctacgtcacaaaccaa
ccggcaccttctatctttcccagcatgaacgatggcttctttaaagacatgggcgcatat
ttgatccccattgggaacttttcattttccgagtgggaggctattccatggggtcttgaa
ggtgtacttgagtatctaaagcagagctataacaatcctccgatctacattcttgaaaat
ggtaaaccgatgatacacgactcgatgctacaggacacaccaagagttgtatacattcaa
gcttacatcggtgttgtgctcaacgccgtcaagaatggatcggacacgagaggttacttt
gtatggtcgatgattgacgtatatgagttaatggctggatatagaaccagcttcggaatg
tactatgtgaatttcagcgatcctggtcgcaacagatctccaaaactctctgcttcttgg
tacactgcttttctcaatggtacaattgatgttgcttctcaagatagtatgattcagttg
cagagaaacctctcaggcttttctttactgtaa

DBGET integrated database retrieval system