KEGG   Camelina sativa (false flax): 104755441Help
Entry
104755441         CDS       T05044                                 

Definition
(RefSeq) aminomethyltransferase, mitochondrial
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00260  Glycine, serine and threonine metabolism
csat00630  Glyoxylate and dicarboxylate metabolism
csat00670  One carbon pool by folate
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01200  Carbon metabolism
Module
csat_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    104755441
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    104755441
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    104755441
Enzymes [BR:csat01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     104755441
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-GeneID: 104755441
NCBI-ProteinID: XP_010476124
Position
17
AA seq 408 aa AA seqDB search
MRGGSLWQLGQSITRRLAQTDKKVVSRRYFASEADLKKTALYDFHVAHGGKMVPFAGWSM
PIQYKDSIIDSTVNCRQNGSLFDVAHMCGLSLKGKDCVPFLETLVVADVAGLAPGTGSLT
VFTNEKGGAIDDSVITKVTDDHIYLVVNAGCRDKDLAHIEEHMKAFKSKGGDVSWHIHDE
RSLLALQGPLAAPVLQHLTKEDLSKLYFGQFQILDINGSTCFLTRTGYTGEDGFEISVPS
EHAVDLAKAILEKSEGKIRLTGLGARDSLRLEAGLCLYGNDMEQHISPVEAGLTWAIGKR
RRAEGGFLGADVILQQLKDGPTIRRVGFFSSGPPARSHSEVHDESGNKIGEITSGGFSPN
LKKNIAMGYVKSGQHKTGTKVKILVRGKPYEGNITKMPFVATKYYKPT
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagaggtggtagtctatggcagctagggcaatccataacacgtcgtcttgctcaaacc
gacaagaaggttgtgtcacgccgctactttgcatctgaagccgacctgaaaaagactgct
ctttatgacttccatgtcgcccacggcggaaagatggttccttttgctggttggagtatg
ccaattcagtacaaagattccatcattgactcaacggttaactgcaggcaaaatgggagt
ttgtttgatgttgcacatatgtgtggtttgagtcttaagggtaaagattgcgttcctttt
cttgagacgcttgtggttgctgatgtggctggtttggctcctggaactgggagcttgacc
gtgttcacgaacgagaaaggaggtgccattgatgactctgtgattaccaaagtgacagat
gaccatatctatttggtagtgaatgctggttgtagggataaggatttggctcacattgaa
gaacatatgaaagctttcaaatccaaaggaggtgatgtctcgtggcatatccatgacgag
agatctcttctcgcccttcagggtcctttggctgctccggtgcttcaacatctgactaaa
gaagacttgagcaagctttactttgggcaattccagattctggacattaatggttccaca
tgtttccttaccaggaccgggtatacaggggaagatgggtttgagatttcggttccatct
gagcacgcagtggatctagcaaaagcaatcttggagaaatccgagggtaagataaggctt
acgggtctaggagcaagagacagtctcaggttagaagcaggactttgtctatatggaaat
gacatggagcagcacatttctcctgttgaagctgggctcacatgggccatagggaagcgt
agaagagccgaaggtggatttcttggcgcggatgtgattctccaacagcttaaagacgga
cctacaatcagaagggtcggttttttctcctcaggaccaccagcaaggtcgcatagcgag
gttcatgatgagagtgggaacaagattggagagatcacaagtggagggtttagcccgaac
ctgaagaagaacatagccatggggtatgtgaagtcaggtcagcacaagaccgggactaaa
gtcaagatcttggttcgtgggaaaccatatgaaggcaacatcacaaagatgccgtttgtg
gccaccaaatactacaagccaacatga

DBGET integrated database retrieval system