KEGG   Camelina sativa (false flax): 104757352Help
Entry
104757352         CDS       T05044                                 

Definition
(RefSeq) probable 9-cis-epoxycarotenoid dioxygenase NCED5, chloroplastic
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00906  Carotenoid biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
Module
csat_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    104757352
Enzymes [BR:csat01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     104757352
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 104757352
NCBI-ProteinID: XP_010478382
Position
17
AA seq 593 aa AA seqDB search
MACSYVLTPNPTKLNLSFAPSDLDAPSPSSSVSFTNTKQGRRSKLSSTNSSISDTTTTLL
NFPNYPSPNPIIPEKDTSRWNPLQRAASAALDFAETALLKRERSKPLPKTVDPRHQISGN
YAPVPEQPVKSSLSVDGKIPDCIDGVYLRNGANPLFEPVSGHHLFDGDGMVHAVKITNGE
ASYSCRFTETERLVQEKQIGSPIFPKAIGELHGHSGIARLMLFYARGLFGLLNHKNGTGV
ANAGLVYFHDRLLAMSEDDLPYQVRITDNGDLETVGRFDFDGQLNSAMIAHPKIDPVTKE
MFALSYDVVKKPYLKYFRFSPDGEKSPDVEIPLASPTMMHDFAITENFVVIPDQQVVFQL
SDMFLGKSPVKYDAEKISRFGILPRNAKDASEMVWVESPETFCFHLWNAWDSPETDEVVV
IGSCMTPADSIFNECDEQLDSVLSEIRLNLKTGKSTRRTIIPGSDQMNLEAGMVNRNLLG
RKTRYAYLAIAEPWPKVSGFAKVDLSTGKVKNHFYGGKKFGGEPFFLPRGLESDGEDDGY
IMSFVHDEESWESELQIVNAVTMELEATVKLPSRVPYGFHGTFVNSADMLNQA
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atggcttgttcttacgtattaacaccaaacccaaccaaactcaatctctcctttgcaccg
tccgatctcgacgctccttctccgtcctcctccgttagtttcaccaacactaaacaagga
cgccgtagtaagctctcgtcaacaaactcatcaatctcagacaccactacaactctactg
aatttcccaaattacccttctccgaaccccataattcccgagaaggacacttcacgttgg
aaccctctccaacgagccgcctccgccgctctcgacttcgccgaaaccgcattgctgaaa
cgcgaacgttctaaacccctccctaaaaccgttgatcctcgccatcagatctccggtaac
tacgctccggtgccggaacaacccgttaaatcgtctctctccgttgacggaaaaatccct
gactgcattgacggcgtttacctccgtaacggcgctaatccactcttcgaaccagtttct
ggtcatcacctattcgacggtgacggtatggttcacgccgttaaaatcactaacggagag
gcgagttactcatgccggtttacggaaaccgagagattggttcaggaaaaacaaatcggt
tcgccgatttttcctaaagccataggtgagctacacggtcactccggtatcgcgcggctg
atgctgttttacgcacgtggtttattcggtttattaaatcacaaaaacggaaccggagtt
gctaacgccggtttggtttactttcacgaccggttattagctatgtccgaagatgatctg
ccttaccaggtccgtattaccgacaatggcgatttagagacggtcggaagattcgatttc
gacggtcagttaaactccgccatgatcgctcaccctaaaatcgatccggtaacgaaggag
atgttcgcgttgagctacgatgtcgttaagaaaccgtatttgaaatacttcagattctcg
ccggacggtgagaaatcgccggacgttgagatcccactcgcgagtccgacgatgatgcac
gatttcgcgatcaccgagaattttgtagtgattccggatcaacaagttgtgtttcaactc
tccgatatgtttctcgggaaatctccggttaagtacgacgcagagaaaatttcccggttt
gggattttgccgagaaacgctaaagacgcgtcggagatggtatgggttgagtcgccggag
actttttgtttccatctttggaacgcttgggactcaccggagactgacgaggttgtggtg
atcggatcttgtatgactccggcggattcaatctttaacgagtgcgatgagcagctcgat
agtgttttgtctgagatccggttaaatctcaaaaccgggaaatcaacgcgaagaactata
attcccggttcggatcagatgaatttagaagctggtatggtaaaccggaatcttctcgga
agaaaaacccggtatgcctacctagcgatagctgaaccgtggcctaaggtgtcgggtttc
gctaaagttgatctttctaccggaaaagttaaaaaccacttttacggcggtaaaaaattc
ggtggtgaacctttttttttaccaagagggttagaatctgacggagaagatgacggttat
attatgtcgtttgttcacgacgaggagagttgggaatcggagcttcaaattgtcaacgcc
gttacgatggagctagaagcaaccgttaaattgccgtcaagagtaccgtatggtttccac
ggcacgtttgtgaattcagctgatatgttaaaccaggcttag

DBGET integrated database retrieval system