KEGG   Camelina sativa (false flax): 104759913Help
Entry
104759913         CDS       T05044                                 

Definition
(RefSeq) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00670  One carbon pool by folate
csat01100  Metabolic pathways
csat01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    104759913
Enzymes [BR:csat01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     104759913
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-GeneID: 104759913
NCBI-ProteinID: XP_010481087
Position
17
AA seq 372 aa AA seqDB search
MSPSSRKLQVVSPVPADIDIANSVEPLHISEIAKDLNINPLHYDLYGKYKAKVLLSAFDE
LQEQEDGYYVVVGGITPTPLGEGKSTTTVGLCQALGAYLDKKVVTCLRQPSQGPTFGIKG
GAAGGGYSQVIPMDEFNLHLTGDIHAITASNNLLAAAIDTRIFHETSQSDKALFNRLCPP
NKEGRRSFSDIMFRRLTKLGISKTSPEELTPEEIKKFARLDIDPASITWRRVMDVNDRFL
RKITIGQGPEEKGMTRETGFDISVASEIMAVLALTTSLGDMRERLGKMVVGNSKAGEPIT
ADDLGVGGALTVLMKDAINPTLMQTLEGTPVLVHAGPFANIAHGNSSIVADKIALKLVGP
GGFVVTEAXVVA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgagtccatcatcgagaaagcttcaggttgtttcaccagttcccgctgatattgatatt
gctaattccgtcgagcctttacacatctctgagattgccaaagatctcaatatcaaccca
cttcactacgatctctacggcaagtataaagctaaggttttgttgtctgcgtttgatgag
cttcaagaacaagaagatggttactatgttgttgttggagggattactccaactcctctt
ggagaaggcaagagtactaccactgttggactttgtcaagccttaggcgcttacctcgat
aagaaggttgttacttgtcttcgccaaccatcacaaggaccaacctttggaatcaaagga
ggtgcagccggtggtgggtatagtcaggtgattcctatggatgagttcaatcttcatctc
actggagatattcatgcgatcactgcttccaacaatctcttagctgctgctatcgacact
cggattttccatgagacatctcaatccgacaaggctctttttaataggttgtgtcctcct
aataaagaagggaggcgtagtttcagtgacattatgttcaggagattgactaagcttggg
atctccaagaccagtccggaggagcttactcccgaggagataaagaaatttgctaggctt
gatattgatcctgcttccatcacgtggagaagagtgatggatgttaatgaccggttcttg
aggaagattactattggtcagggacctgaggaaaaagggatgaccagagaaactggtttt
gatatatctgttgctagtgagattatggctgttttggctttgacaacctctcttggtgat
atgagagagaggcttggtaaaatggtggttggtaacagcaaggccggagagccgataaca
gctgatgatcttggtgttggaggagccttgaccgttctgatgaaagacgctatcaacccg
acactcatgcagacacttgaagggacacctgtccttgttcatgctggtccttttgcaaac
atagctcatggaaattcatcaattgttgctgataaaatcgctttaaagctggtgggacct
ggtggattcgtggtaacagaagcangtgttgttgcttag

DBGET integrated database retrieval system