KEGG   Camelina sativa (false flax): 104760978Help
Entry
104760978         CDS       T05044                                 

Definition
(RefSeq) heat shock 70 kDa protein 7, chloroplastic isoform X1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
csat  Camelina sativa (false flax)
Pathway
csat03040  Spliceosome
csat04141  Protein processing in endoplasmic reticulum
csat04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:csat00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    104760978
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104760978
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104760978
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:csat01009]
    104760978
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:csat03041]
    104760978
   03009 Ribosome biogenesis [BR:csat03009]
    104760978
   03110 Chaperones and folding catalysts [BR:csat03110]
    104760978
   04131 Membrane trafficking [BR:csat04131]
    104760978
   03051 Proteasome [BR:csat03051]
    104760978
   03029 Mitochondrial biogenesis [BR:csat03029]
    104760978
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csat04147]
    104760978
Protein phosphatases and associated proteins [BR:csat01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     104760978
Spliceosome [BR:csat03041]
 Complex B
  Other components
   Prp19 complex
    104760978
 Complex C
   Prp19-CDC5 complex
    104760978
Ribosome biogenesis [BR:csat03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    104760978
Chaperones and folding catalysts [BR:csat03110]
 Heat shock proteins
  HSP70 / DNAK
   104760978
Membrane trafficking [BR:csat04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    104760978
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    104760978
Proteasome [BR:csat03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    104760978
Mitochondrial biogenesis [BR:csat03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    104760978
Exosome [BR:csat04147]
 Exosomal proteins
  Proteins found in most exosomes
   104760978
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl StbA BcrAD_BadFG FtsA Hydantoinase_A DUF5398 baeRF_family12
Motif
Other DBs
NCBI-GeneID: 104760978
NCBI-ProteinID: XP_010482286
Position
18
AA seq 717 aa AA seqDB search
MASSAAQFHILGGIGFPTSSSSNKILDGKTNSTPRSVFFGNRTTPFSTPNSAFLRMGRRN
TGGASRYSVGPVRVVNEKVVGIDLGTTNSAVAVMEGGKPTIITNAEGQRTTPSVVAYTKN
KDRLVGQIAKRQAVVNPENTYSSVKRFLGTEMKEVGEEAKQVSYRVVKDDNGNVKLDCPA
MGQQFSPEEISAQVLRKLVDDASRFLNDKVTKAVITVPAYFNDSQRTATKDAGRIAGLEV
LRIINEPTAASLAYGFEKKSNETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGGD
DFDKRVVDWLASTFKKDEGIDLTKDKQALQRLTEAAEKAKIELSSLTQTNMSLPFITATA
DGPKHIETTLTRAKFEELCSDLLDRVRKPVENSLRDAKLSFNDIDEVILVGGSTRIPAVQ
ELVRKLTGKEPNVSVNPDEVVASGAAVQAGVLSGDVRDIVLLDVTPLSLGLETLGGVMTK
IIPRNTTLPTSKSEVFSTAADGQTSVDINVLQGEREFVRDNKSIGSFRLDGIPPAPRGVP
QIEVKFDIDANGILSVSASDKGTGKKQDITITGASTLPKDEVDTMVQEAERFAKEDKEKR
DAIDTKNQADSIVYQTEKQLKELGEKIPGPVKEKVEAKLQELKEKIASGSTQEIKETMAA
LNQEVMQIGQSLYNQSQSGGAGSPPGGEASSASDSSSSTKGGDNVDDVIDADFTDSN
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctccgccgcacaattccacatcctcggcggaatcggattccctacttcttct
tcatcaaacaaaatcctcgatggtaaaaccaattccactccacgaagcgtcttcttcggc
aacagaaccactcctttctctactccaaactccgccttcctccgtatgggaagaagaaac
accggcggagcttccagatactcggttggtccagtccgtgtggttaacgagaaagtagtc
gggatcgatttaggtacgacgaactcagccgtagctgtcatggaaggaggtaaaccaacg
attataactaacgctgaaggtcagagaactacgccttctgttgtggcttacacgaagaac
aaagatagacttgttggtcagattgcgaagcgtcaggctgttgttaatccggagaacact
tattcatctgtgaagaggtttttgggtacggaaatgaaagaggttggtgaagaggctaag
caggtttcttatagagttgttaaagatgataatggcaatgttaagcttgattgtcctgct
atgggtcaacagttctctcctgaggagatctctgctcaggttttgaggaagcttgtggat
gatgcttcgaggtttttgaatgataaagtaactaaagctgtcatcactgtgcctgcttac
tttaatgattcacaaaggacggctactaaagatgctgggcgtattgctggattggaagtt
cttcgtattatcaatgagcctactgctgcttctttggcttatggctttgagaagaaaagc
aatgaaactattctagtctttgatcttggtggtggtacttttgatgtctcagtccttgag
gttggtgatggtgttttcgaagtgctttctacttctggtgatacacatttgggaggtgat
gactttgacaagagagttgttgattggcttgcttcaactttcaagaaagatgaaggcata
gatcttaccaaagacaagcaagcgcttcagaggttaactgaggcagctgaaaaagctaaa
attgagctttcctcactgactcagactaacatgagtttgccttttatcactgctacggct
gatggtcctaagcacattgaaaccactctcacccgagccaaatttgaagaattgtgctct
gacttactcgacagggtaaggaaaccggtggagaattccttgagggatgcgaagctcagt
ttcaacgatattgatgaggtgattcttgttggtggatccacacgtattcctgctgttcaa
gaactcgtaaggaaactgacagggaaagaacccaatgtgtcagtcaatcctgatgaagtc
gtagcttcaggtgctgcagttcaggctggtgttctatctggagatgtgagggacattgtt
cttcttgatgtgacgccactgtcgcttggtttggaaactcttggtggtgtcatgaccaag
atcattccaagaaacaccacacttccaacttctaaatcagaagtcttctcaactgctgca
gatggacagacaagtgttgatattaatgtgttacagggtgagagagagttcgtaagagat
aacaagtctattggtagcttccgtcttgatggtatcccgcctgcaccacgtggagttcca
caaatcgaggtcaaatttgatattgatgccaatggaattctatctgtcagtgcttccgac
aaaggcacaggaaagaagcaggacatcaccattactggtgctagtaccttgccaaaggat
gaggtagacacaatggtccaagaagcagagaggtttgccaaggaagacaaagaaaagaga
gatgcgattgacacaaaaaaccaggctgattccatcgtgtaccagacggagaagcagctg
aaagaacttggagagaaaattccaggtccagtgaaagaaaaggtcgaggctaagctccaa
gagctgaaggagaagatagcaagtggatcaacccaagaaatcaaagagaccatggcagct
cttaaccaagaagtgatgcagattggccagtctctgtacaaccaatcccaatcaggtggt
gctggttctcctcctggaggtgaagcttcctcggcatctgactcatcatcttcaaccaaa
ggtggagacaatgttgatgatgtgatcgacgctgacttcactgacagcaactaa

DBGET integrated database retrieval system