KEGG   Camelina sativa (false flax): 104762505Help
Entry
104762505         CDS       T05044                                 

Definition
(RefSeq) cyclin-dependent kinase E-1
  KO
K02208  cyclin-dependent kinase 8/11 [EC:2.7.11.22 2.7.11.23]
Organism
csat  Camelina sativa (false flax)
Brite
KEGG Orthology (KO) [BR:csat00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csat01001]
    104762505
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:csat03021]
    104762505
Enzymes [BR:csat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     104762505
    2.7.11.23  [RNA-polymerase]-subunit kinase
     104762505
Protein kinases [BR:csat01001]
 Serine/threonine kinases: CMGC group
  CDK family
   104762505
Transcription machinery [BR:csat03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    CDK-module
     104762505
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 104762505
NCBI-ProteinID: XP_010484111
Position
18
AA seq 469 aa AA seqDB search
MGDGSSTRSNSSNSSNEKPEWLQQYNLVGKIGEGTYGLVFLARTKTPPKRPIAIKKFKQS
KDGDGVSPTAIREIMLLREISHENVVKLVNVHINFADMSLYLAFDYAEYDLYEIIRHHRD
KVGHSINTYTVKSLLWQLLNGLNYLHSNWIIHRDLKPSNILVMGDGEEHGIVKIADFGLA
RIYQAPLKPLSDNGVVVTIWYRAPELLLGSKHYTSAVDMWAVGCIFAELLTLKPLFQGAE
AKSAQTPFQLDQLDKIFKILGHPTMDKWPTLVNLPHWHNDVQHIQAHKYDSVGLHNVVHL
NQKSPAYDLLSKMLEYDPLKRITASQALEHEYFRMDPLPGRNAFVATQPMEKNVNYPTRP
VDTNTDFEGTTSINPPQAVAAGNVAGNMAGAHGMGNRSMPRPMVAHNMQRMQPQGMMAYN
FPAQAGMNPSVPLQQQRGMAQPHQQQQLRRKDPGMGMSGYAPPNKTRRL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgggagatgggagttccactagatccaacagctcgaacagcagcaatgagaaaccagag
tggctgcaacagtacaatctcgttggtaagattggtgaaggaacctatggtcttgttttc
ttggctagaaccaagaccccgcctaaaagaccaattgccatcaagaagtttaagcagtca
aaagacggagatggagtttccccaactgctatccgcgagatcatgttgctcagagagatt
tcccatgagaacgtcgtgaagcttgtgaatgtccacatcaattttgcagacatgtctctg
tatcttgcctttgattatgccgagtacgatctctacgaaatcatcaggcaccacagagac
aaagtaggccattcgataaacacatacacagttaagtctttgctctggcagcttctcaac
gggttgaactatcttcacagtaattggattatacacagagacttgaaaccctcgaatatc
ttggttatgggggatggagaagaacacggaatagtgaaaatagccgacttcgggcttgca
aggatatatcaagctccgttgaaaccgctatcagataacggagttgtggtcacaatctgg
tacagagcaccagagctgcttcttggctcgaagcactatacaagcgccgtcgatatgtgg
gctgttggatgtatattcgcggagttacttactctgaaaccgttgttccaaggagcagaa
gcgaagtcggctcaaacccctttccagttagatcaactcgacaagatatttaagatctta
ggccacccgacgatggataaatggccaacgctagttaacctcccgcactggcataacgat
gttcaacacattcaagctcacaaatacgacagcgttggtctccacaacgtggtacacctg
aatcagaaaagtcctgcgtatgatctcctatccaaaatgcttgaatatgacccgctcaag
cggatcacggcttcacaagcactagaacatgagtatttccgaatggatcctctgccagga
cgtaacgcatttgtagccacccaaccgatggagaagaacgtgaattacccaactcgtcca
gtcgacacaaacacggatttcgaaggcacgacgagcatcaatcctcctcaagcagtagca
gcaggaaacgtagcagggaacatggctggagctcatggaatgggcaatagatcgatgcca
agaccaatggttgcacataacatgcagaggatgcaacctcaaggcatgatggcttataat
ttcccagcgcaagcggggatgaacccgagtgttccgctgcagcagcagcgtgggatggct
caaccgcaccagcagcaacagctaagaaggaaggatcctggaatgggtatgtcaggttac
gcacctcctaacaaaaccagacgcctctaa

DBGET integrated database retrieval system