KEGG   Camelina sativa (false flax): 104764123Help
Entry
104764123         CDS       T05044                                 

Definition
(RefSeq) serine/threonine-protein kinase WNK1 isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
csat  Camelina sativa (false flax)
Brite
KEGG Orthology (KO) [BR:csat00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csat01001]
    104764123
   01009 Protein phosphatases and associated proteins [BR:csat01009]
    104764123
Enzymes [BR:csat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104764123
Protein kinases [BR:csat01001]
 Serine/threonine kinases: Other
  Wnk family
   104764123
Protein phosphatases and associated proteins [BR:csat01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104764123
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 104764123
NCBI-ProteinID: XP_010485877
Position
19
AA seq 696 aa AA seqDB search
MNNLSYLEPDYSEFVEVDPTGRYGRYNEVLGKGASKTVYRAFDEYEGIEVAWNQVKLYDF
LQSPEDLERLYCEIHLLKTLKHKNIMKFYTSWVDTANRNINFVTELFTSGTLRQYRLRHK
RVNIRAMKHWCRQILRGLHYLHSHDPPVIHRDLKCDNIFVNGNQGEVKIGDLGLAAILRK
SHAAHCVGTPEFMAPEVYEEAYNELVDIYSFGMCILEMVTFDYPYSECTHPAQIYKKVMS
GKKPDALYKVKDPEVKCFIEKCLATVSLRVSARELLDDPFLRIDDGEFDLRSVDMDDSVG
PLVRQPHHLPDYYNYTSNSSSLNRQYSNGNYTSNSSSLNRQYSNGYSSPNEYQNGWAYNP
AETEETHGIELFECRNDDDQEQDKTSGNVDITIKGKRRDDGGLFLRLRIADKEGRVRNIY
FPFDIETDTALSVATEMVAELDMDDHGVTKIANMIDGEISSLVPRWRPGPEFEECLAAAA
AANAASICNNCVSNRTSMGSVMDFLRTNPGANVIQCCRNGCGETHGRFEEITIRETEVRL
RELWKLQQQQESRELSSIDSGQNHSEEEEEEEEEVYENPENTFSCEAGNGIINHFGSFSF
IPSKYCDEEVYEKSENQVQQDLRWLKAKCQIELRDIQDEQLQTRWPESGEESEISPLGSV
SGLEGDKVKEQQMYGGRLVPKCLKRTTSLPIDAIDS
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatctgagttatcttgaaccagattactctgagtttgttgaagttgatcctact
ggaagatatggaagatataatgaagttctgggtaaaggagcttcaaagactgtttacaga
gcatttgatgaatacgaagggatagaagtagcatggaaccaagtgaagctttacgatttc
ctacagagccctgaggatcttgagaggctttactgtgagattcatctcctcaagacttta
aaacacaagaacattatgaaattctatacttcctgggtggatacagccaatcgaaacatc
aattttgttactgagttgttcacttctggcaccttgagacagtatagactcaggcataag
agagtaaacataagagcgatgaagcattggtgtagacagatcttgagaggcttacattat
cttcacagccatgatcctcctgtgatccacagggatctcaaatgtgacaacattttcgtt
aacgggaatcaaggagaggtcaagattggagatctcggcctcgctgccattttaagaaag
tcccatgctgctcactgcgttggaactcctgagttcatggcacctgaagtttacgaagaa
gcgtataacgaactggtagatatatactcgttcggtatgtgcattttggagatggtcacg
tttgattacccgtacagcgaatgtactcaccctgctcagatctacaagaaagttatgtcg
ggcaagaaaccggatgcattatacaaggtgaaagaccctgaagttaaatgttttatcgag
aaatgcttggccactgtatcccttagagtctctgctcgtgagttactagatgaccctttt
cttcgaatagacgatggtgaatttgacttgagatcagttgatatggatgattcggtcggg
ccacttgttaggcagccgcatcatcttcctgactactacaactacacgtcaaatagtagc
tctttgaaccgtcagtactcaaatggcaactacacgtcaaatagtagctctttgaaccgt
cagtactcaaatggttatagtagccccaacgagtaccagaacggatgggcatataatcca
gctgagacagaggagactcacggaatcgagctctttgagtgtcgaaacgatgatgatcaa
gaacaagacaagacatctggtaatgttgatattaccatcaaagggaagagaagagatgat
ggtggcctattcttgcgtcttaggatcgccgacaaagaaggacgtgtccgaaacatttac
ttcccatttgacatcgagacagacacggcactgagcgttgcaacagagatggtagcggaa
ctagatatggatgatcacggagtcacaaagatcgccaatatgattgatggtgagatatct
tctcttgtgcccaggtggagaccgggccctgaattcgaagaatgtcttgcggctgcagcg
gcagcaaatgctgcgagcatttgcaacaactgcgtgtcgaaccgcacctcaatggggtcg
gtgatggatttcttgaggaccaatcctggtgcgaatgtgatacaatgttgcagaaatggg
tgcggagagactcatggccggtttgaagagatcacgatcagagaaaccgaggtgcgtctt
agagagctatggaagctgcagcaacagcaggaaagccgtgagctaagctcaatagactca
gggcaaaaccactccgaagaagaagaagaagaggaagaagaggtatatgaaaaccctgaa
aacacgttttcttgcgaggcaggtaacggaataataaaccactttggatccttctcgttt
ataccttctaaatactgcgacgaggaggtatacgagaaaagcgaaaatcaggtccaacaa
gatttgagatggcttaaagctaaatgccagattgaactgagagatattcaagatgagcaa
ttacaaacccggtggccggaatccggagaagagtcggagatttctcctttgggttcggtt
tcagggttggaaggagataaggtgaaagaacaacagatgtatggaggaagattggtacca
aagtgtctaaaaaggacaacttcacttcctattgatgccattgattcttga

DBGET integrated database retrieval system