KEGG   Camelina sativa (false flax): 104764406Help
Entry
104764406         CDS       T05044                                 

Definition
(RefSeq) DEAD-box ATP-dependent RNA helicase 50-like
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
csat  Camelina sativa (false flax)
Brite
KEGG Orthology (KO) [BR:csat00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:csat03041]
    104764406
   03009 Ribosome biogenesis [BR:csat03009]
    104764406
Enzymes [BR:csat01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     104764406
Spliceosome [BR:csat03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    104764406
Ribosome biogenesis [BR:csat03009]
 Eukaryotic type
  90S particles
   Helicases
    104764406
  Pre-60S particles
    104764406
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C ResIII
Motif
Other DBs
NCBI-GeneID: 104764406
NCBI-ProteinID: XP_010486230
Position
19
AA seq 770 aa AA seqDB search
MLARAPPPCFNFPARNNNNICNRSEIVRLFRNRGGGGVVSSGGFTRRPLETSSSYDDSTD
DGFVIITAADKDNGFSHPPPPSSDSIPSESGRRNGSRSRGVTASFGRLKAQKVKALVGKV
TQKKQHMSHSEEDEDEDDASDDGDFNEDEGFVGSSSILDLMRKKLAMKAIPRSGKSFEKK
EVQRFSKVRESRESRKDFDRLGGDDEDIEREGSRSSYSKGYDANSRGKGDRLSVARDLDP
FEGRDRAIDEVSNPRKYTDNERAGSRSSYSRDSAVNSRGREDKRFVAKDLDTFQGRDKAY
DEVYNPQRFSNNERGGSYSKGSAGNSRGWGDRRSVVYARDMDDWREQRNKTNATRETGFF
SRKTFAEIGCSQDMMKALKEQNFDRPAHIQALAFAPVIDGKSCIIAEQSGSGKTLSYLIP
VIQRLREEELQGISKSSPGCPRVIVLVPTAELASQVLANCRSISKSGVPFRSMVVTGGFR
QRTQLENLEQGVDVLIATPGRFTYLMKEGILGLSNLRCAILDEVDILFGDDEFEAALQSL
INSSPVTAQYLFVTATLPLEIYNKLVEVFPDCEVVMGPRVHRVSNALEEILVDCSGDDNA
EKTPETAFQNKKTALLQIVEENPVPKTIIFCNKIETCRKVENIFKRVDRKERQLHVLPFH
AALAQGSRLTNMEEFTLSQPEENSLFLVCTDRASRGIDFSGVDHVVLFDFPRDPSEYVRR
VGRTARGARGEGKAFIFVVGKQVRLAQRIIERNQKGHPVHDVPSAYESTT
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgttggcgagagctccaccaccgtgttttaattttccggcgaggaataataataatatc
tgtaatcggagtgagattgtgcgattgtttcgtaaccgcggaggcggaggagtggtatct
agtggtggtttcactcggcggccgttggaaacttcgagctcttacgacgattccaccgac
gacggattcgttatcatcactgcggcggataaggataatggcttctctcatcctcctccg
ccttcttccgattcgattccctcagaatctgggagaagaaacggttcgcgttcgagaggt
gtaactgctagtttcggaaggctaaaggctcaaaaagtaaaagctcttgttggaaaggta
acgcagaaaaagcagcatatgagtcatagtgaggaggacgaagatgaggatgacgcctct
gatgatggggattttaacgaggatgaaggttttgttggttcatcttcaattcttgatttg
atgaggaagaagcttgctatgaaggctattcctagatcaggcaaatcttttgagaaaaaa
gaggttcaaagattcagcaaagtgagggaatctagagagtcaagaaaggattttgataga
ttaggaggagatgatgaagatattgagagagaagggtcacggagttcatattcaaaaggt
tatgatgctaactccaggggtaagggagataggctttcggttgcaagagatttagatcca
tttgaaggacgtgatagagctattgatgaggtttcaaaccctcgaaagtatactgacaat
gagagagcaggatcacggagttcatattcaagagactctgctgttaactctaggggtagg
gaggataagcgttttgttgccaaagacttggatacattccagggacgtgataaagcttat
gatgaggtttataatcctcaaaggttcagtaataacgagagaggaggatcgtattcaaaa
ggctctgctggtaactctcggggttggggtgataggcgttctgttgtatatgcaagagat
atggacgattggagagagcaaaggaataaaaccaatgctactagggagactggctttttt
agccggaaaacttttgctgaaattggatgtagtcaagatatgatgaaggccttaaaggaa
cagaattttgatcgcccggcacacattcaggctctggcttttgcaccagttattgatgga
aagagttgtatcatagctgaacaaagtggatcaggcaagacactctcatatcttatccct
gttattcagcgtctcagagaagaagaacttcaaggaattagcaaatcctcccctgggtgt
cctcgtgttattgttctggtaccaactgcagagttggcttctcaggttcttgctaactgt
agatcaatatcaaagtctggggtccctttccgttccatggtagtgacgggtggcttcaga
caacgaacccagctagaaaacttagagcaaggtgttgacgttttgattgcaacaccaggg
cgtttcacgtacctaatgaaagaaggaattttggggttatcaaatttaagatgtgccatc
ttggatgaagtggatatactctttggcgacgatgagtttgaggcagccctgcaaagtcta
ataaactcttcgcctgttactgcacagtatctgtttgttacagcaaccttgccgcttgag
atatataacaaacttgttgaagttttccctgattgtgaagttgtaatgggacctcgtgtg
caccgtgttagtaatgctctcgaagagattcttgttgactgcagtggagatgataatgca
gagaaaactcctgagactgcttttcagaacaagaaaactgctcttcttcagattgtggag
gaaaaccctgttcccaaaactatcattttctgcaataagattgagacatgtaggaaagtt
gagaatatatttaagcgggttgatagaaaggaaaggcagttgcatgtcctaccttttcat
gcagcacttgcacaagggtcaaggcttacaaacatggaagaattcaccttatctcagccg
gaagaaaattcactgtttctggtttgcacggatagagcctcccgtgggatagatttctct
ggtgttgatcatgtggtgctctttgacttcccgcgtgaccccagtgaatacgtgagacgt
gtaggaagaacagcaagaggggctagaggagaaggaaaggctttcatctttgtggtgggg
aagcaagtaaggttggcacagaggataattgagcgaaatcagaagggtcacccagttcat
gatgtcccaagcgcttacgaatccacaacataa

DBGET integrated database retrieval system