KEGG   Camelina sativa (false flax): 104764642Help
Entry
104764642         CDS       T05044                                 

Definition
(RefSeq) heat shock 70 kDa protein 3-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
csat  Camelina sativa (false flax)
Pathway
csat03040  Spliceosome
csat04141  Protein processing in endoplasmic reticulum
csat04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:csat00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    104764642
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104764642
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104764642
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:csat01009]
    104764642
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:csat03041]
    104764642
   03009 Ribosome biogenesis [BR:csat03009]
    104764642
   03110 Chaperones and folding catalysts [BR:csat03110]
    104764642
   04131 Membrane trafficking [BR:csat04131]
    104764642
   03051 Proteasome [BR:csat03051]
    104764642
   03029 Mitochondrial biogenesis [BR:csat03029]
    104764642
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csat04147]
    104764642
Protein phosphatases and associated proteins [BR:csat01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     104764642
Spliceosome [BR:csat03041]
 Complex B
  Other components
   Prp19 complex
    104764642
 Complex C
   Prp19-CDC5 complex
    104764642
Ribosome biogenesis [BR:csat03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    104764642
Chaperones and folding catalysts [BR:csat03110]
 Heat shock proteins
  HSP70 / DNAK
   104764642
Membrane trafficking [BR:csat04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    104764642
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    104764642
Proteasome [BR:csat03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    104764642
Mitochondrial biogenesis [BR:csat03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    104764642
Exosome [BR:csat04147]
 Exosomal proteins
  Proteins found in most exosomes
   104764642
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 104764642
NCBI-ProteinID: XP_010486515
Position
19
AA seq 649 aa AA seqDB search
MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDNERLIGDAAKN
QVAMNPINTVFDAKRLIGRRFNDSSVQSDRQLWPFKIISGPGEKPMIVVNYKGEDKEFSA
EEISSMILIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFDGVDFY
SPITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVDDVVLVGGSTRIPKVQQLLLDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
QRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIERMVQEAEKYKSEDEEHKK
KVDAKNALENYAYNMRNTIRDEKIGEKLAADDKKKIEDSIEAAIEWLEGNQLAECDEFED
KMKELESLCNPIIAKMYQGGEAGGPAPGGMDEDVPPPAGGAGPKIEEVD
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtaaaggagaaggtccagcgattggtatcgatctcggtaccacttactcttgt
gttggagtttggcaacacgaccgtgttgagatcattgctaatgatcaaggtaaccgtacc
accccttcttacgtcgccttcaccgacaacgaacgcttgatcggtgacgccgccaagaat
caggtcgccatgaaccccatcaacactgttttcgatgcaaagaggttgattggtcgaaga
ttcaatgacagctctgttcaaagcgacagacaattgtggcctttcaagatcatctccgga
cctggtgaaaaaccaatgattgtcgtgaactacaagggagaagacaaggagttttctgct
gaagagatctcttccatgattctcatcaagatgcgtgagattgctgaagcttaccttggt
accacgatcaagaacgctgttgtaactgttcctgcttacttcaatgactctcagcgtcaa
gctacaaaggatgctggtgtcattgctggtttgaatgttatgcgtatcatcaacgagcct
actgctgctgcgattgcttatggtttagacaagaaggcgactagtgttggtgagaagaac
gttttgatctttgaccttggtggtggtactttcgatgtctctcttcttaccattgaggaa
ggtatctttgaggttaaggcgactgctggagacactcatcttggtggtgaggattttgat
aacaggatggtgaaccactttgtccaagagtttaagaggaagaacaagaaggacattagt
gggaacccgagagctctaaggaggttgagaaccgcctgtgagagagcgaagaggactctt
tcctctactgctcagactactatcgaaatcgactctctgtttgatggtgttgacttctac
tctccgatcacacgtgctagattcgaggagcttaacatggatcttttcagaaagtgtatg
gagcctgttgagaagtgtcttcgtgatgctaagatggacaagagctcagttgatgatgtt
gtcctagttggtggctctacccgtattcccaaggtccaacagttgctcctcgatttcttc
aatggcaaggagctttgcaaatccatcaaccccgatgaggctgttgcttatggtgcagct
gtccaggcagctattcttagcggtgagggtaacgagaaggttcaagatctcctcttgctc
gatgtcacaccactttctcttggtcttgaaaccgctggaggagtcatgactgttttgatc
cagagaaatacaaccatcccaacaaagaaagaacaagtcttctcaacttattcagacaac
caacccggtgtcttgatccaagtctatgagggcgagagagcaagaaccaaagacaataac
cttttgggtaaatttgagctttccggcatccctccagctccaagaggtgttcctcagatc
actgtctgtttcgacattgatgcgaacggtatcctcaacgtctcggctgaggacaagacg
actgggcaaaagaacaagatcacaatcaccaacgacaaaggaagattgtcaaaggacgag
attgagagaatggttcaagaagctgagaagtataagtcagaggatgaagagcacaagaag
aaggtggacgccaagaacgctcttgagaattacgcatacaacatgaggaacacaatccgt
gatgagaagattggtgagaagcttgcagcagatgacaagaagaagattgaagactctatt
gaagcagccattgaatggcttgaaggcaaccagctagcagagtgtgatgaatttgaggac
aagatgaaagagctcgagagtctttgcaacccaatcatagcgaagatgtatcaaggtggt
gaagctggtggtccagctccaggaggaatggacgaggatgttcctcctcctgctggaggt
gcaggtcccaagatcgaggaagtcgattaa

DBGET integrated database retrieval system