KEGG   Camelina sativa (false flax): 104765172Help
Entry
104765172         CDS       T05044                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV5-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00052  Galactose metabolism
csat00500  Starch and sucrose metabolism
csat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104765172
   00500 Starch and sucrose metabolism
    104765172
Enzymes [BR:csat01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     104765172
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 104765172
NCBI-ProteinID: XP_010487151
Position
19
AA seq 576 aa AA seqDB search
MNNMVWCNRAIFLLISLFLANNALVVLDALHNVPNHIKNQPYRTGYHFQAPKNWMNDPNG
PMVYKGIYHLFYQWNPNGALMEVNDTVWGHATSTDLINWITHSPAIKPSRPSDINGCWSG
SVTILPNGKPVLLYTGNDRYNRQVQNLAIPKNLTDPYLRHWTKSPENPLVTPGDANHINS
TAFRDPTTAWLGRDGRWRITTGSQDGRRGLAILHTSRDFVRWKQSMKPLHYHDGTGMWEC
PDFFPVARTDSRGVDTTAFNGKMVKHVLKVSLTDTFHDYYTIGTYDQVRDVYVPDNGFVQ
DETAPRYDYGKFYASKTFYDSVYQRRILWGWVNESSTDKDIVNMGWARLQAIPRKVWLDE
SGKSLVQWPVKEIESLRTTQVKWGNKVLKGGGSVMEVHGVTASQADVEVFFKVSGLDLEK
ADVIEPGWTDPQLICSQKNASLVKSGLGPFGLMVLVSKNLEEYTSVYLRIFKARENSKEH
VVVMCSDQSRSSLEKGNDKTPYGAFVDVSPYQTISLRTLIDNSIVESFGGKGKACITSRV
YPKLATGKRTHLFAFNKGSQSVDVLSLSAWSMKSTR
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgaataatatggtttggtgtaacagagccattttcttgttaatctcgttgtttcttgct
aacaatgctcttgttgttcttgatgccttgcacaacgtccccaatcatatcaagaaccaa
ccttaccgaaccggttatcacttccaggccccaaaaaattggatgaacgatcctaacggg
cctatggtatacaaaggaatctaccatctattttaccaatggaacccaaacggcgccctc
atggaagttaacgacactgtatggggtcacgcaacatcaacggaccttatcaactggatc
acacattctccagccatcaaaccatctcgaccgtccgatatcaacggatgctggtccggc
tccgtcacgattctccccaatggcaaacccgtacttctctacacaggcaacgaccgttac
aaccgtcaggtccaaaacctagccatacccaaaaacctaaccgatccatatctccggcac
tggacaaaatctccggaaaatcccctcgtgacacctggcgacgccaaccacatcaactcc
accgcgtttcgtgacccaaccaccgcgtggctaggccgtgatggaagatggcgtattacc
acgggaagccaagacggtcgccgagggttagcgattctacacacgagccgcgatttcgta
aggtggaagcaatctatgaagcctctacattaccacgacggcactgggatgtgggagtgc
cctgattttttcccggtggcgagaactgattcacgcggcgtagatacgacggcgtttaat
gggaagatggtaaaacacgtgcttaaagtgagcttaacagatacgtttcatgattactac
acgattggaacgtacgaccaagtgagagatgtctacgtaccggacaatggttttgttcag
gacgaaacggctccgagatacgactacggcaagttttacgcgtcgaagacgttttacgac
tcggtttatcaacggaggattttgtggggttgggttaacgagtcgtcgacggataaggac
attgtcaatatgggttgggcccgtttacaggctattcctaggaaagtatggcttgatgaa
tcaggaaagagtttggtgcaatggccagttaaggaaatagagagtttacgtacaacgcaa
gtcaagtggggcaacaaagttttgaaaggcggaggatcggtcatggaggttcatggggtc
acagcttcacaagcagatgtggaggttttctttaaagtgagtggtttagacttagagaaa
gcagatgtgattgaaccaggttggaccgacccgcaattgatttgcagccagaagaatgca
tcgttggttaagtccggtttaggtccatttggtttgatggtactagtttccaagaacttg
gaagagtacacatcagtgtatctcagaatcttcaaagctcgtgagaatagtaaggagcat
gtggtggtcatgtgcagtgaccaaagcagatcaagtttagagaaaggaaatgataaaaca
ccgtatggtgcttttgtggatgtctctccttatcaaacaatctctctcaggactttgatt
gataattcaatagtggagagctttggtgggaaagggaaagcatgtattacctcaagagtt
tatccaaaattggcaacaggaaaaagaacacatctctttgcttttaacaagggatctcag
agtgttgatgttttaagcctaagtgcttggagcatgaagtctactcgctaa

DBGET integrated database retrieval system