KEGG   Camelina sativa (false flax): 104766799Help
Entry
104766799         CDS       T05044                                 

Definition
(RefSeq) tyrosine decarboxylase 1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00350  Tyrosine metabolism
csat00360  Phenylalanine metabolism
csat00380  Tryptophan metabolism
csat00901  Indole alkaloid biosynthesis
csat00950  Isoquinoline alkaloid biosynthesis
csat00965  Betalain biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    104766799
   00360 Phenylalanine metabolism
    104766799
   00380 Tryptophan metabolism
    104766799
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    104766799
   00950 Isoquinoline alkaloid biosynthesis
    104766799
   00965 Betalain biosynthesis
    104766799
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csat04147]
    104766799
Enzymes [BR:csat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     104766799
    4.1.1.105  L-tryptophan decarboxylase
     104766799
Exosome [BR:csat04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104766799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 104766799
NCBI-ProteinID: XP_010489054
Position
19
AA seq 490 aa AA seqDB search
MENGSKKVLKPMDSEQLREYGHRMVDFIADYYKTIEDFPVLSQVQPGYLHKLLPDSAPDH
PETLDQVLDDVRSKILPGVTHWQSPSFFAYYPSNSSVAGFLGEMLSAGLGIVGFSWVTSP
AATELEMIVLDWLAKLLNLPKEFMSKGNGGGVIQGSASEAVLVVLLAARDKALRSVGKNT
LEKLVVYSSDQTHSALQKACQIAGIHPENCRMLETDASTNYALRPELFQEAVSRDLEAGL
IPFFLCANVGTTSSTAVDPLAALGKIANNNEIWFHVDAAYAGSACICPEYRQYIDGVETA
DSFNMNAHKWFLTNFDCSLLWVKDQDSLTEALSTNPEFLKNKASQANLVVDYKDWQIPLG
RRFRSLKLWMVLRLYGAETLKNYIRNHIKLAIVFEQLVSQDPNFEIVTPRIFSLVCFRIV
PANNDEKKCNNQNRKLLDAVNSSGKLFISHTALSGKIVLRCAIGAPLTEEKHVKEAWKVI
QDEASFLLHK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatggaagtaagaaggtgttgaagccgatggattcagagcaactgagagaatac
ggacatcgaatggttgatttcattgccgattattacaaaaccattgaagatttccctgtt
cttagtcaagttcagcctggttatcttcataagcttttgcctgattctgcaccagaccac
cctgaaactctagatcaagttcttgatgatgtgcggtcgaagatcttgcctggagttacg
cattggcaaagtccgagtttctttgcttattacccttctaacagcagtgtcgccggtttc
ttgggtgagatgttgagtgctggtcttggtattgttggttttagttgggttacttctcca
gctgccaccgagctcgagatgatcgttcttgactggcttgccaaactgctcaacctaccc
aaggagtttatgtccaaaggaaacggaggtggagtgatacaagggtcagctagtgaagct
gttctcgttgttctgctcgctgcccgcgataaagccttaagaagcgttggcaaaaacaca
cttgagaagctcgttgtctactcctctgaccagactcattcagctttacagaaggcttgc
cagattgctggaatccatccagagaactgcagaatgctagaaaccgatgcctctacaaat
tacgctctgcgtccagaattgtttcaagaagctgtttctcgggatcttgaagctggactg
attccattctttttatgcgctaatgttggaaccacttcttcaaccgccgttgatccatta
gctgcactaggaaagatcgctaacaacaatgagatatggtttcacgtggatgcagcgtac
gctggaagtgcttgtatatgtccagagtaccgacaatacatcgacggtgtagaaactgca
gattcttttaacatgaatgctcacaaatggttcctcactaattttgattgttcacttctt
tgggtaaaggatcaagattctctcactgaagcgctttcaactaatccagagtttctcaaa
aacaaggcctctcaggcaaacttggttgttgattacaaagactggcaaatccctctcgga
cgaagattcagatcattgaaactatggatggttttacgactctatggagctgagaccttg
aagaactacatcagaaaccatatcaaactggctatagttttcgaacaacttgtctctcaa
gatcctaactttgagattgtcacacctcgaatcttttctcttgtctgtttccgcattgtg
cctgcaaacaacgatgaaaagaagtgtaataaccaaaaccgcaaactcctagacgcagtg
aactcttcagggaaactcttcatttctcacactgctttgtcgggaaaaatcgttctacgt
tgcgccataggagcaccattgacggaggagaagcacgtgaaggaggcgtggaaggttatt
caggatgaagcatctttcttgcttcacaagtaa

DBGET integrated database retrieval system