KEGG   Camelina sativa (false flax): 104768702Help
Entry
104768702         CDS       T05044                                 

Definition
(RefSeq) probable protein S-acyltransferase 3
  KO
K16675  palmitoyltransferase ZDHHC9/14/18 [EC:2.3.1.225]
Organism
csat  Camelina sativa (false flax)
Brite
Enzymes [BR:csat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     104768702
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC MENTAL DUF3810
Motif
Other DBs
NCBI-GeneID: 104768702
NCBI-ProteinID: XP_010491036
Position
20
AA seq 412 aa AA seqDB search
MQRERMSKKKSSQVHCIPSDDLILMTASTSKHISQIRLYKAWKGNNRFFCGGRLIFGPDV
SSLFLTSFLIGAPALTFCIRMLVWIRKGDPFFNYMVLTSGFILTLLAFMFLVLTSARDPG
IIPRNKTSMNIEDDSDSSLTQSMEWVNNKTPNLKIPRTKDVFVNGYTIKVKFCDTCLLYR
PPRASHCSICNNCVQRFDHHCPWVGQCIARRNYPFFICFISTSTLLCIYVFVFSWINLIR
QPGKLWRTMSYDIVSVILIVYSFVAVWFVGGLTIFHFYLMSTNQTTYENFRYRYDRKENP
YKRGFLKNVTEVLFAKIPPSQLDLRAMVPEEDDMTIASNGSEYESEYSSSVRYDIEMGGK
LTKRESPKKLPLPTQNLDIKDISDDYDRSKMTREDASEHDPSFFSTQLDLPK
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcagagggagagaatgagcaagaagaagagcagtcaggttcattgtattccctctgat
gatcttattctcatgacggcttcaacttctaaacacatttctcaaatcagattgtacaaa
gcctggaagggtaacaacagattcttctgtggtggtagactaatctttggtcctgatgta
tcatctctgttcctaacctcgttcttgattggagctcctgcgcttacgttctgcataagg
atgctcgtgtggatcagaaaaggcgatcctttcttcaactacatggttctgacttcagga
tttatcctcaccctcttggcttttatgtttctagtcttgacatcagctagggatccagga
atcatcccaaggaataaaacatcaatgaatattgaagatgattcagatagttccttgaca
caatctatggaatgggtcaacaacaaaactcctaatctcaagattccaagaaccaaggac
gttttcgtcaacggttacacgatcaaagtcaagttctgtgatacttgcttgctctatcgt
ccacctcgagcatcacattgctccatctgcaacaactgcgtccaacgctttgatcatcat
tgtccttgggttggacagtgcattgcccggagaaactacccgttctttatctgcttcatc
tcaacttcaacattgttatgcatatatgtctttgtcttctcctggatcaatctgattcga
cagcctggcaaactatggaggacaatgtcttatgatatagtgtctgtcattcttatcgtc
tattcattcgttgctgtctggttcgttggtggccttaccattttccacttctatctcatg
tctacaaaccagacaacatatgagaatttccggtaccgttatgacaggaaagaaaatcct
tacaagagagggtttctgaagaatgttacagaagtattatttgctaagatcccgccttcg
caactagatctcagagcaatggtcccggaagaagatgacatgacaatagcatctaacgga
tccgagtatgagtcagagtatagctcctccgtgagatatgatatagaaatgggaggcaag
ctcactaaaagagagagcccgaaaaagcttcctctgcctacacaaaacttagatatcaag
gacattagtgatgactacgacagatctaagatgactagagaggatgcttctgagcatgat
ccttccttcttctcaactcaactagatttgccaaagtaa

DBGET integrated database retrieval system