KEGG   Camelina sativa (false flax): 104772977Help
Entry
104772977         CDS       T05044                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00450  Selenocompound metabolism
csat00970  Aminoacyl-tRNA biosynthesis
csat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    104772977
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    104772977
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:csat01007]
    104772977
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:csat03016]
    104772977
Enzymes [BR:csat01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     104772977
Amino acid related enzymes [BR:csat01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   104772977
Transfer RNA biogenesis [BR:csat03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    104772977
 Prokaryotic type
   Other AARSs
    104772977
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 Anticodon_1
Motif
Other DBs
NCBI-GeneID: 104772977
NCBI-ProteinID: XP_010495831
Position
Unknown
AA seq 799 aa AA seqDB search
MEDGGKSDGPKLPIPGKRNILITSALPYVNNVPHLGNIIGCVLSADVYARYCRLRGYNAI
YICGTDEYGTATETKALEENCTPKEICDKYHAIHKEVYDWFDISFDKFGRTSTPEQTEVC
QAIFKKLWDNKWLSENTMQQLYCDTCKKFLADRLVEGSCPFKGCNYDSARGDQCEKCGKL
LNPTELKDPKCKVCQNTPRIRDTDHLFIELPLLKDKLEEYIKETSVAGSWSQNAIQTTNA
WLRDGLRQRCITRDLKWGVPVPHEKYKEKVFYVWFDAPIGYVSITSCYTSEWEKWWKNPE
NVELYQFMGKDNVPFHTVMFPSTQLGTGENWTLMKTISVTEYLNYEDGKFSKSKGVGVFG
NDVKDTNIPVEVWRYYLLTNRPEVSDTSFSWKDLQAKLNGELLSNLGNFVNRVLSFIAKP
ESSGYGSVIPDAPGAESHPLTISLAEKVEKLVAEYVEAMEKVKLKQGLKTAMLISNEGNF
YLQANQFWKLYKDDKPSCAIVIRTAAGLVHLIAQLLEPFMPSFSCEVFKQLNLPLHFSLS
DERGEVLLASRPWDILPPSHRIGTPQPLFKELVDEEVQQYREKFAGSQADRRARDEAANL
TDQLNKTKLSDAKKQKASSSKSGGKPKPQPAADREITMARLDIRVGKIVKAERHPRADAL
YVEEIDVGGGEIRTVVSGLVNYIPLEEMQNRMVCVLCNLKPAKMRDIVSQAMVLAASSSD
GSKVELVEPPESAIIGERVIFPGFEGEPDDLLNPKKKIFETLAVDLHTNENLVACYKDVP
FTTSAGVCKVSSISNGPVR
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atggaagacggcggaaagagcgacggccccaagttaccaatccctggaaagagaaatata
ctaatcaccagtgctcttccttacgtcaacaacgttcctcatctcggaaacatcattgga
tgtgttctgagcgctgatgtgtatgctagatactgtcgtctccgtggctataatgcgata
tacatatgtgggactgatgagtatgggactgcaactgagaccaaagctttggaggagaat
tgcacccccaaggaaatctgtgacaagtaccatgccattcataaagaagtttatgactgg
tttgatataagttttgacaagtttgggcgaacttcaactccagaacagactgaagtgtgc
caagcaattttcaagaagttgtgggacaacaagtggctttcagagaacaccatgcagcag
ctttattgcgatacatgcaagaagttcttagctgaccggcttgttgagggttcttgtccg
tttaaagggtgcaattatgattctgctcgtggagatcagtgcgaaaaatgtggaaaactt
ctgaatcctactgaacttaaagatccgaagtgcaaggtctgtcaaaacacaccccgaatt
cgcgacacagaccacctgtttattgagcttccgttgctgaaagataagttggaagagtat
attaaggagacatctgttgctggatcttggagtcaaaatgctattcaaacaacaaatgca
tggcttagggatgggcttagacagagatgcattacaagggatcttaaatggggagtacct
gtcccacatgagaaatataaggagaaagtcttctatgtttggtttgatgctcctattgga
tacgtctcaataacgtcatgctacacatctgaatgggagaagtggtggaagaatcctgag
aatgtggagctttatcagtttatggggaaagacaatgtgccatttcacactgtgatgttt
ccctctacgcagcttggaaccggggaaaattggacgctgatgaagacaatcagtgtgacc
gaatatttaaactatgaagatggaaagttctccaagagtaaaggtgttggagtgtttggt
aatgatgtaaaagatacaaatatacctgtcgaagtatggagatactacttgctgacgaac
aggcctgaggtgtctgacacatcattttcatggaaagatttgcaagcaaaactgaatggc
gagttgttaagcaacctaggcaactttgttaatcgagttctgagtttcatagcaaagccg
gaaagttcaggttatgggtctgtcattcctgatgctcctggtgctgagtctcatccttta
acaatatcactggctgaaaaggttgaaaagttggtggcagagtatgttgaagccatggaa
aaggttaagctcaagcaggggctgaaaactgccatgctgatttcaaatgaagggaacttt
tacttacaggcaaaccaattctggaaactctacaaggacgataaaccttcttgtgcaatt
gttataagaaccgctgctggtttagtacaccttattgctcaattgttagaacctttcatg
ccgtccttttcttgtgaggtatttaaacaactaaatttgcctctacatttttctctctcc
gatgagaggggggaggtattactagcaagtagaccatgggatattctacctcccagccac
aggataggcacccctcaacctttgttcaaggagttggttgacgaagaagtgcaacagtac
agagaaaagttcgctggaagtcaggctgatagacgtgccagggatgaagcagcaaatttg
acagatcaacttaacaaaacaaaactttcagatgccaagaaacaaaaagcatcatcatca
aaaagcggaggaaaacccaaacctcaaccggctgctgatcgtgaaataactatggcaaga
cttgatattcgagttggtaaaattgtgaaggctgagagacatcctagggcagatgcattg
tatgtagaagaaattgatgttgggggaggtgaaatccgcactgttgttagtggactggtc
aactatatacctcttgaggaaatgcagaaccgtatggtttgtgttctttgcaacttgaag
ccggcgaagatgagggatattgtgtcgcaagcaatggttcttgcagcttccagtagtgat
ggcagcaaggtggagttagttgagccccctgaatctgctattattggtgagcgagttata
tttcccgggtttgaaggcgagccagacgatctcttaaacccaaagaagaaaatatttgag
acactcgcggtggatctacacacaaatgagaatctagttgcttgctacaaagatgtgccc
ttcactacatctgcaggtgtatgcaaagtttcatccatcagcaatggcccggtccggtaa

DBGET integrated database retrieval system