KEGG   Camelina sativa (false flax): 104774265Help
Entry
104774265         CDS       T05044                                 

Definition
(RefSeq) probable polygalacturonase At3g15720
  KO
K01184  polygalacturonase [EC:3.2.1.15]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00040  Pentose and glucuronate interconversions
csat01100  Metabolic pathways
Module
csat_M00081  Pectin degradation
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    104774265
Enzymes [BR:csat01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.15  endo-polygalacturonase
     104774265
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_28 FLYWCH_N
Motif
Other DBs
NCBI-GeneID: 104774265
NCBI-ProteinID: XP_010497211
Position
Unknown
AA seq 224 aa AA seqDB search
GHGISIGSLGKDGETATVENVCVQNCNFRGTTNGARIKTWQGGSGYARMITFHGITLDNV
ENPIIIDQLYNGGDSDKAKDHKSSAVEVSNVMYSNFVGTSKSEYGVDFRCSERVPCTDIF
LRDVKIATASSGSGQVAQGQCLNVRGASTLAVPGLECLALTANMLSSPEQTCMLAQSVQP
RTQPMQDPIWDFESRGKRLIVSNTVLFSFISLVTYSFRLLMENF
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
ggccatggaataagcataggaagcttgggaaaagatggggagacagctaccgttgagaat
gtatgtgtccaaaactgtaacttcagaggaactacgaatggggctcggatcaaaacttgg
cagggcggatcgggttacgcaagaatgattacattccatggaataactctagacaatgta
gaaaatccaattattatcgatcagctctacaacggaggagattctgataaagccaaagat
cataagtcgtcggcagtggaagtgagcaatgtgatgtatagtaatttcgttgggacgtcg
aagtcagagtacggagttgacttcaggtgcagcgagagagtaccgtgcacagatattttc
ttgagagacgtgaaaatagcaaccgcatcatcaggatcaggacaagtcgcacaaggacaa
tgtttaaacgtgagaggtgcgtccacactcgctgtcccaggtctagaatgcttagccctt
accgcaaatatgttgtcatcgccggaacaaacttgcatgttggcacaatcagtgcaacca
agaacacaaccgatgcaagatccaatatgggattttgaaagcagagggaaacgacttata
gtttccaataccgtattattttcatttatctctttggttacatacagttttagattatta
atggaaaacttctaa

DBGET integrated database retrieval system