KEGG   Camelina sativa (false flax): 104779392Help
Entry
104779392         CDS       T05044                                 

Definition
(RefSeq) probable LRR receptor-like serine/threonine-protein kinase At1g56140
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
csat  Camelina sativa (false flax)
Brite
KEGG Orthology (KO) [BR:csat00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csat01001]
    104779392
Enzymes [BR:csat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104779392
Protein kinases [BR:csat01001]
 Serine/threonine kinases: TKL group
  IRAK family
   104779392
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase EphA2_TM CTV_P6
Motif
Other DBs
NCBI-GeneID: 104779392
NCBI-ProteinID: XP_010502042
Position
3
AA seq 287 aa AA seqDB search
MDGFWVFNSLSAPVHVLGVIVGVVLLSIFAGVVIIIIRKRRKRYTVYEEILSMDVKPNTF
TYSELKNASQDFNPSDKLGEGGFGSVYKRIRLYILIGQPVINGYQCSGYLAPEYAMRGHL
TEKTDVYAFGVVALELVSGRKNSDENLEEEKQYLLEWVHAWNLHEKSRDFELVDDELKEY
KMEEVKRMIGIALLCTQSSHALRPPMSRVVAMLTGDVEVNDATSKPGYLTDCTFDGTTSS
SFSNFQTNNTSLSTIFVTPAPETATLSQCLDTSYHNLLKKQISHITQ
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggatggattttgggttttcaattccttgtctgcccctgttcatgtattgggtgtcatt
gttggcgttgtacttttgagtatctttgcaggtgttgttatcatcattatccgaaaaaga
agaaagcggtacacagtttatgaagaaatacttagtatggatgtaaagcctaacaccttc
acttactcggaactcaaaaatgcaagtcaagatttcaatccctcggacaagcttggagag
ggaggatttgggtctgtttataaaagaataagactttacatcttgattggtcaacccgtt
atcaatggatatcaatgcagtggatatcttgcgccagagtatgctatgcgtggacattta
acagagaaaacagatgtgtatgcctttggtgttgtggctcttgagctagtgagtggaagg
aaaaactctgatgagaacctggaagaggaaaaacaataccttcttgaatgggtacacgca
tggaatttacatgagaaaagccgagactttgaactagttgatgatgagctaaaggaatac
aaaatggaagaagtgaaacgcatgattggcattgctctgctttgcactcagtcatctcat
gcgttgagaccaccaatgtcacgagtggtagccatgttgacaggagatgttgaggtcaat
gatgccacctctaagccaggctacctaaccgactgtacatttgatggcaccacaagctca
tctttcagcaactttcaaaccaataacacaagcttatctacgatctttgtgacgcctgcc
ccagagacagcgactctaagccaatgcttagatacatcatatcacaatctattgaagaaa
cagatttcacatataactcaataa

DBGET integrated database retrieval system