KEGG   Camelina sativa (false flax): 104779676Help
Entry
104779676         CDS       T05044                                 

Definition
(RefSeq) erlin-2-B-like
  KO
K23341  erlin
Organism
csat  Camelina sativa (false flax)
Brite
KEGG Orthology (KO) [BR:csat00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:csat04121]
    104779676
Ubiquitin system [BR:csat04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    104779676
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7
Motif
Other DBs
NCBI-GeneID: 104779676
NCBI-ProteinID: XP_010502373
Position
4
AA seq 357 aa AA seqDB search
MDGQQRRTEIPRAPPVGGEPGGDVSSIFIAFGVFAAIAALVMFPSSLVHQVPEGHVGAYW
RGGALLNIITEPGFHLKLPFITNYEPVQVTLQTDQVKDIPCGTKGGVMITFEKIEVVNRL
RKDFVYDTLLNYGVNYDNTWIYDKIHHEINQFCSSHSLQQVYIDIFDQIDERMKDALQAD
CTRYAPGIEILSVRVTKPKIPESVRRNFEQMEEERTKVLIAIEKQRVAEKEAETKKIMAI
SEAEKNANVSKILMQQKLTEKDSSRREADIENQMYLDRQKSLADADYYRVLREAEANKLK
LTPEFLELKFIDAIARNTKIFFGDKVPNMVLDQRLLGNFLNHSAKDKDGSLEMATDT
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggatggtcagcaacggagaactgaaatccctcgcgcaccaccggtcggaggagagcct
ggtggagatgtatcttctattttcattgcgttcggtgttttcgctgcaatcgccgccttg
gttatgttcccgtcatcgttggtgcatcaagttcctgaaggtcacgttggagcgtattgg
agaggtggtgctcttctaaacataatcacagagccaggttttcacttgaagctgcctttc
attaccaactatgagcctgttcaagttactctacaaacagatcaagtgaaggatatacca
tgtggtaccaagggaggtgtcatgattacctttgagaagatagaagttgttaatcgactg
cgtaaggattttgtctatgacactttgctcaactatggtgtgaactatgataacacatgg
atatatgacaagattcatcatgagatcaaccagttttgcagctctcattcacttcagcaa
gtctacattgatatctttgaccagattgatgaacgaatgaaagatgctctccaagctgat
tgtacacgttatgctccaggaattgagattcttagtgtccgtgtcacaaagccgaaaatt
ccagagagtgtaaggcgaaactttgagcagatggaagaggaacgcactaaggtcttgatt
gctattgagaaacaaagagttgctgagaaagaggcagagacaaagaagataatggccatt
agtgaagctgagaagaacgccaatgtaagcaagattctgatgcaacaaaagttgactgag
aaagacagttcacggagagaagcagacatcgagaatcagatgtatcttgaccgtcaaaag
agtctcgcagatgcagattactaccgtgtactgagagaagctgaagcaaacaagttgaag
ctcacccctgaatttctcgaactcaaattcatcgatgccattgctcgtaacaccaaaata
ttcttcggggacaaggtacctaacatggtgttggatcaaaggctgcttgggaacttcctc
aatcattcggcaaaagacaaagatggaagcttggaaatggccactgatacatag

DBGET integrated database retrieval system