KEGG   Camelina sativa (false flax): 104780387Help
Entry
104780387         CDS       T05044                                 

Definition
(RefSeq) mitogen-activated protein kinase 3
  KO
K20536  mitogen-activated protein kinase 3 [EC:2.7.11.24]
Organism
csat  Camelina sativa (false flax)
Pathway
csat04016  MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:csat00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    104780387
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csat01001]
    104780387
Enzymes [BR:csat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     104780387
Protein kinases [BR:csat01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   104780387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Haspin_kinase APH FTA2
Motif
Other DBs
NCBI-GeneID: 104780387
NCBI-ProteinID: XP_010503182
Position
4
AA seq 370 aa AA seqDB search
MNTGGGQYTDFPAVETHGGQFISYDIFGSLFEITSKYRPPIIPIGRGAYGIVCSVLDSET
NELVAMKKIANAFDNHMDAKRTLREIKLLRHIDHENIIAIRDVVPPPLRRQFSDVYIATE
LMDTDLHQIIRSNQGLSEEHCQYFLYQLLRGLKYIHSANIIHRDLKPSNLLLNANCDLKI
CDFGLARPTSENDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPLFP
GKDHVHQMRLLTELLGTPTESDLGFTHNEDAKRYIRQLPNFPRQPLAKLFSHVNPLAIDL
VDRMLTFDPNRRITVEEALNHQYLAKLHDPTDEPICQKPFSFEFEQQPLDEEQIKDMIYQ
EAIALNPTYG
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccggcggcggtcaatacacggatttcccggcggtggagactcacggaggacag
tttataagttacgatatcttcggtagtttattcgagatcacatctaagtatcgtcctccg
attatcccaattggtcgtggagcttatggaatcgtttgctctgtgttggattcggagacg
aacgagctagtagcgatgaagaagatagcgaatgcttttgataatcatatggatgcgaaa
cgtacgcttcgtgagatcaagcttcttcgtcatatagatcatgaaaacattatagctata
agagatgtggttccaccaccactacgaaggcagttcagtgatgtttacattgctactgag
ttaatggatactgatcttcaccaaatcattagatctaaccaagggttatcagaggaacac
tgtcagtacttcttgtaccagcttcttagagggctgaagtatatccactcagctaacatt
atccatagagatttaaagccgagcaatcttctgttgaacgcgaactgcgatttaaagatc
tgtgatttcggtcttgctagacctacttctgagaatgactttatgaccgagtatgttgtt
actagatggtatagagcacctgagcttctgttaaactcttctgactacacagctgctatt
gatgtttggtctgttggttgtatctttatggagcttatgaatagaaagcctttgttccct
ggtaaagaccatgttcatcaaatgcgcttattgacagagttgcttggcacaccgacagaa
tctgatcttggcttcacacacaacgaggatgcgaaaagatacatccggcaacttcccaac
ttccctcgccagccgttagcaaaacttttctctcatgttaacccattggccattgatcta
gttgacagaatgttgacgtttgaccccaacagaagaatcactgttgaagaagctctgaat
catcagtacctcgccaaattgcacgacccaactgatgagccaatctgtcaaaagccattc
tctttcgagttcgaacaacagcctctggacgaggaacagatcaaagatatgatctaccag
gaggctatagcactcaatccaacgtacggttag

DBGET integrated database retrieval system