KEGG   Camelina sativa (false flax): 104780453Help
Entry
104780453         CDS       T05044                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 5-like
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00520  Amino sugar and nucleotide sugar metabolism
csat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    104780453
Enzymes [BR:csat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     104780453
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 NAD_binding_4 3Beta_HSD RmlD_sub_bind
Motif
Other DBs
NCBI-GeneID: 104780453
NCBI-ProteinID: XP_010503253
Position
4
AA seq 341 aa AA seqDB search
MASSDKQTSPKPPPSPSPLRNSKFCPSNMRILISGGAGFIGSHLVDKLMENEKNEVIVAD
NYFTGSKGNLKKWIGHPRFELIRHDVTEPLLIEVDRIYHLACPASPIFYKYNPVKTIKTN
VIGTLNMLGLAKRVGARILLTSTSEVYGDPLIHPQPESYWGNVNPIGVRSCYDEGKRVAE
TLMFDYHRQHGIEIRIARIFNTYGPRMNIDDGRVVSNFIAQALRGEALTVQKPGTQTRSF
CYVSDMVDGLMRLMEGNDTGPINIGNPGEFTMVELAETVKELINPSIEIKMVENTPDDPR
QRKPDITKAKEVLGWEPKVKLREGLPLMEEDFRLRLGVPKE
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaagtgataagcaaacaagcccaaagcctccaccttcaccttcacctctccgt
aattccaagttttgtccgtccaatatgaggatcttgatctcaggaggagctggattcatt
ggctctcaccttgttgataagctgatggaaaatgaaaagaatgaggtgattgttgctgat
aactatttcaccggttcaaagggaaaccttaagaagtggatcggtcatccgagatttgag
cttatccgtcacgatgtcacggagccacttttgattgaggttgatcggatttaccatctc
gcatgtcctgcttctcccatcttctataagtacaaccctgtgaagacaatcaagaccaat
gtgattggtacactgaacatgctaggtcttgccaagcgtgttggagcaaggattttgctt
acctcaacctcggaagtgtatggagatcctctgatccatccccagcctgagagctactgg
ggaaatgtcaacccaattggggttaggagctgttatgacgaaggcaagcgtgtggctgag
accttgatgtttgactaccacaggcaacatggaattgaaatccgcattgccagaatcttc
aacacctatggtccacgcatgaacattgatgatggccgtgttgtaagcaacttcattgct
caagcactacggggtgaggcattgactgttcagaaaccagggacacagactcgcagtttc
tgttatgtatctgacatggttgatggacttatgcgcctcatggaaggaaatgacactggt
cccatcaacattggtaacccaggtgagtttaccatggtggaactagctgagacagtgaag
gagctgattaacccgagcatagagataaagatggttgagaacacaccagatgatccaaga
cagaggaagccggacatcacaaaggcaaaagaagtgttgggatgggaaccaaaggtgaaa
ctccgtgaaggtcttccccttatggaagaagacttcaggctaaggctcggagtccccaaa
gaataa

DBGET integrated database retrieval system