KEGG   Camelina sativa (false flax): 104784162Help
Entry
104784162         CDS       T05044                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C-like
  KO
K03252  translation initiation factor 3 subunit C
Organism
csat  Camelina sativa (false flax)
Pathway
csat03013  RNA transport
Brite
KEGG Orthology (KO) [BR:csat00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    104784162
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:csat03012]
    104784162
Translation factors [BR:csat03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    104784162
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N Regnase_1_C
Motif
Other DBs
NCBI-GeneID: 104784162
NCBI-ProteinID: XP_019099739
Position
4
AA seq 747 aa AA seqDB search
MVRVRNPNELYNLRFSLSLLLLPNYRLLGCSIGFYLLQISSHCIFVHQSGSDSEYESDVD
EEWDVVQDTNAASASRYLPGGSDSEDDDLRKRVVQPAKDKRFEEMVSTTELMKNAIKINN
WVSLQDNFDKINKQLEKVMRITEAVKAPILYIKTLVMLEDFLNETLANKEAKKKMSTINS
KALNSMRQRLKKNNKRYEEEIIKYRESPETEEVNESEDEDSKDDDEDDVNVEADSEEEEE
ANDKGDPSWEKMLSKKDKLMEKLYNKDPKEITWDWVNQKFKEVVAARGKKGTARFELVDQ
LTHLIRIAKTPAQKLEILFSVISAQFDVNPGLNGHMPIKVWKKCVNNMLTILDILVKYDN
IVVDDTIEPDENETSKPEDFDGTIRVWGNLVAFVERIDTEFFKSLQCIDPHTRDYVERLR
DEPMFLALAQNIQDYFERSGDYKAAAKVALRQVELIYYKPQEVYDAMRKLAELVVEEEEE
DSEAPKEGAGPPASFIVVPEVVPRKPTFPESSRAMMDVLVSLIYKYGDERTKARAMLCDI
YHLAVVDEFVSARDLLLMSHLQDNIQHMDISTQILFNRSMAQLGLCAFRVGMITESHSCL
SELYSGQRVRELLAQGVQQSRYHEKTPEQSVNIENEANCSATFWSHQERLERRRQMPYHM
HINLELLEAVHLICAMLLEVPNMAANSHDVKRKVISKNFRRLLEISERQAFTAPPENVRD
HAMAATRALIKGDCQKAFEVVKSXRQL
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atggttagggttcgaaaccctaatgaactctataatttaaggttctcattgtcattgctt
ctattgcctaactatcgtctattgggttgctccattggtttttacttacttcaaatttct
tctcattgtatctttgttcaccagagtggaagtgatagtgaatatgagagtgatgtcgac
gaagagtgggacgtggttcaagataccaatgctgctagtgcctcgcgttaccttccaggt
ggcagtgatagtgaggacgatgatctccgtaaacgtgttgttcagccagccaaagacaag
cgttttgaagagatggttagtaccacagagctgatgaagaatgccattaagatcaataac
tgggttagtctacaagacaactttgataagattaacaagcagttggaaaaagttatgagg
attacagaggctgtcaaggctccaatcttgtacatcaaaacccttgtgatgttggaagat
ttcctaaacgaaactctggccaacaaggaagcaaagaaaaagatgagcactatcaactcc
aaggccttgaattcaatgaggcagagattgaagaagaacaacaagcgctatgaagaggaa
attatcaaatatagggagtcgccagaaaccgaggaagtgaatgaatcagaggatgaagat
tctaaagatgacgacgaggatgacgttaatgtggaggctgattctgaagaggaggaggaa
gccaacgataaaggtgatccctcttgggagaagatgcttagtaagaaagataaacttatg
gagaagttgtataataaagatcctaaagagatcacatgggactgggtcaaccaaaagttc
aaagaagttgtggctgcccgtggaaagaagggaactgcacgatttgaactcgtagatcag
cttacacacctgataaggattgccaaaactccagcacagaaacttgaaatcttgtttagt
gttatttctgcacagtttgatgtgaatcctggtctcaatggacacatgcctatcaaggtc
tggaagaagtgtgtgaataacatgcttacgatactggacattcttgtcaaatatgataac
attgttgtcgatgatacaattgagcctgatgagaatgaaacttcaaaaccagaagatttt
gatggaacaattcgggtctggggtaaccttgttgcttttgtggagaggatagacactgaa
tttttcaagagtttgcagtgcatagatcctcatacacgtgactatgtggagagattgaga
gatgagccgatgttcttagctcttgctcaaaacatccaagactactttgagcggtctggt
gactataaagctgcggcaaaggtggccttaagacaagttgagttaatttactacaaacct
caggaagtttatgatgccatgaggaaactggctgagctggtggtggaagaagaagaagaa
gatagtgaggctcccaaagagggagctggacctcccgcttcattcattgttgttccagag
gttgttcctcgtaagcctaccttcccagagagcagtcgagctatgatggatgttctcgtc
tcccttatttacaaatatggagatgaacgaaccaaagcacgtgcgatgttatgcgatata
tatcatcttgctgtagtagatgagtttgtgtctgctagggacttgttgctgatgagtcat
ctgcaggacaatattcagcacatggacatctcaacccagatcctatttaataggtccatg
gcgcagcttggtctatgcgcgttccgggttggaatgattaccgaatctcacagctgcctg
tctgaactgtactctggtcaaagggtgcgggagttgcttgctcaaggtgtccagcaaagc
cgatatcatgagaagactcccgagcagtctgttaatattgagaatgaagctaactgttct
gcaaccttttggtcccaccaggagagattggaaaggaggagacagatgccatatcacatg
cacataaaccttgagcttcttgaagctgttcatctcatatgtgccatgctactagaggtc
cctaacatggcagccaattctcatgatgtcaaacgtaaggtgattagcaagaattttcgt
cgcctgctcgagatcagcgagaggcaagcattcactgctcctcctgagaacgttcgtgac
catgccatggcagcaacccgagctctcattaaaggagactgccaaaaggcttttgaagtt
gtgaaatctncaagacaactttga

DBGET integrated database retrieval system