KEGG   Camelina sativa (false flax): 104785791Help
Entry
104785791         CDS       T05044                                 

Definition
(RefSeq) lysine-specific demethylase JMJ30-like isoform X1
  KO
K10277  lysine-specific demethylase 8 [EC:1.14.11.27]
Organism
csat  Camelina sativa (false flax)
Brite
KEGG Orthology (KO) [BR:csat00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csat03036]
    104785791
Enzymes [BR:csat01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.27  [histone-H3]-lysine-36 demethylase
     104785791
Chromosome and associated proteins [BR:csat03036]
 Eukaryotic Type
  Histone modification proteins
   Histone demethylases
    104785791
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cupin_8 Cupin_4 JmjC Cupin_2
Motif
Other DBs
NCBI-GeneID: 104785791
NCBI-ProteinID: XP_010509367
Position
1
AA seq 418 aa AA seqDB search
MSGTTTVSSGDFNNLRLPTPALDAESHSLLQSISAQGGYAYARMAALAVSGDKSAAEAAR
DMAWEQLHSGPWHSVLPVWRDAYSMACLHVAKIHFAAGEFGEALGALDMGLIMGGMLLRK
DLHDSVLLVSSEARKKTKSLEEASGDFKGEKLVPEVPVDVNEVLKILPSRSLSCRRVEKS
SGLSLEGFLRDYFQSGTPVVITNCMAHWPARTKWNHLDYLNAVAGYRTVPVEVGKNYLCS
DWKQELVTFSQFLERIRTNKSSSMEPTYLAQHPLFDQINELKDDICIPDYCFVGGGEIQS
LNAWFGPAGTVTPLHHDPHHNILAQVVGKKYIRLYPSSLQDELYPYSETMLGNSSQVDLD
NIDKTEFPKAMELEFMDCILEEGEMLYIPPKWWHYVRSLTMSFSVSFWWSNETDSSSS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaaccaccaccgtttcctccggagacttcaacaacctccgtctcccaacccca
gcgctcgacgccgaatcgcactccctgctgcaatcaatctcagctcaaggcggttacgcc
tatgctcgcatggcggcgctagctgtttccggcgacaaaagcgcagcggaggcggcccgt
gatatggcttgggagcaacttcactccggtccatggcactcggttctccccgtatggcgc
gacgcttactcaatggcttgtctccacgtcgctaaaatccacttcgccgccggcgagttt
ggtgaggcgcttggtgcgcttgatatgggtcttatcatgggagggatgcttctccgcaag
gatcttcacgattctgttttattggtctcctctgaagctcgtaagaagaccaagagcctt
gaagaagcttctggagatttcaagggtgagaaattggtcccggaagttcccgtcgacgtc
aatgaggtgcttaagattctacctagcaggtccttaagttgtagaagagtagagaagagt
tctggtttatctttggaggggttcctgcgtgattattttcagtcaggtacaccagttgta
ataaccaattgtatggctcattggccagccaggaccaagtggaaccacttggactacctc
aatgctgttgctggttaccgaaccgttcccgtggaggtggggaaaaactatttgtgttct
gattggaagcaagagcttgtgacgttttctcagttccttgaacggattcgaaccaataaa
tcttcttccatggaacctacttatcttgcccagcatccgttgtttgatcagataaacgaa
ctgaaagatgatatatgtattcctgattactgttttgtcggtggcggggaaatccaatct
cttaatgcgtggtttggcccggctgggactgttactccgttacaccatgatccacatcac
aatatacttgctcaggttgttggcaagaagtatataaggctttacccatcctccctgcaa
gacgaactttacccttactctgagacaatgctcggcaactctagccaggttgatctggac
aatatagacaagaccgagttcccaaaggcaatggagttggagtttatggattgtatccta
gaagaaggtgaaatgctgtacatccctcccaaatggtggcactatgtcaggtccttaaca
atgagtttctcggtcagcttctggtggagcaatgaaacagattcttctagctcataa

DBGET integrated database retrieval system