KEGG   Camelina sativa (false flax): 104787948Help
Entry
104787948         CDS       T05044                                 

Definition
(RefSeq) protein PHYLLO, chloroplastic isoform X1
  KO
K14759  isochorismate synthase / 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase / 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase / O-succinylbenzoate synthase [EC:5.4.4.2 2.2.1.9 4.2.99.20 4.2.1.113]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00130  Ubiquinone and other terpenoid-quinone biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    104787948
Enzymes [BR:csat01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     104787948
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     104787948
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     104787948
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     104787948
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N MR_MLE_C TPP_enzyme_M_2 Abhydrolase_1 Abhydrolase_6 TPP_enzyme_C Hydrolase_4 BAAT_C Thioesterase Ndr DLH Abhydrolase_2 Abhydrolase_3 Esterase Chlorophyllase TPP_enzyme_M DUF676 DUF2974 LIDHydrolase Lipase_3 PGAP1 SIR2_2
Motif
Other DBs
NCBI-GeneID: 104787948
NCBI-ProteinID: XP_010511911
Position
5
AA seq 1719 aa AA seqDB search
MRSSFIVSNPPFLPSLIPRHSSRNSFRRSRERRFSSFAESLRVSLHGIGRNIQVVAQGVQ
FDGPIMSRDDALEVNLDDDLMVQVCVTRTLSPALTLELGLESLKEAVDELKTNPPKSSCG
VLRFQVAVPPRAKALFWFCSQPTSSSVFPVFFLSKETVEPSYKSLYVKEPHGVFGIGNAF
SFVHPSSIDSKGHRKTFLSDESAMVTAYGFLDIDFNEHSTVNSKDGSSYFFVPQIELDER
EEISILAVTLAWNDSLSYSFEQTICSYEKSFFQVSCHLCPNLEEHWFKHLKSSIAKFSAK
EIHPIEMEHMRFFTFSEIDQADAKELKNIRSSCQFHCKLSPGVFFSNNMLNPEAEVSSFL
KDEANINAVWASAIIEECTRLGLTYFCVAPGSRSSHLAIAAANHPLTTCLACYDERSLAF
HAIGYAKGSLKPAVIITSSGTAVSNLLPAVVEASEDFIPLLLLTADRPPELQGVGANQAI
NQVNHFGSFVRFFFNLPPPTDLIPVRMVLTTIDSAIHWATGSACGPVHLNCPFRDPLDGS
PTNWSSDCLNGLDIWISNAEPFTKYIQLQSLESNGITTGQINEVLQVIKEAKKGLFLIGA
IHSEDEIWASLLLAKELMWPVVADVLSGVRLRKLFKPFLEKWSPAFVDHFDLALLSDSVR
DLMEFDVVIQVGSRITSKRVSQVLTKCFPFAYILVDKHPCRHDPSHLVTHRVQSNIVQFA
DCVLKSRFPWRRSKLHGHLQALDGAIAREMSFQISAESSLTEPYVAHMLSKALTSKSALF
IGNSMPIRDVDMYGCSSENYSHVVDMMVSAELPCQWIQVTGNRGASGIDGLLSSATGFAV
GCKKRVVCVVGDISFLHDTNGLAILKQRISRKPMTILVINNRGGGIFRLLPIAKRTEPSV
LNQYFYTSHDVSIENLCLAHGVRYVHVGTKSELEDALVVPSVEEMDCIVEVESSINANAI
VHSTLERFARQAAENALGIISASSLCHPMIGNVLVCQVSGIQYSQYRVKLCDRPTICSDE
FSQFHREGFILSLTLEDGSIGYGEVAPLDSNVENLMDVEGQLQLVLHLMDGAKFSYMLPL
LNGSISSWIWSELGINASSIFPSVRCGLEMALLNAMAVRHDSSLLGILHYQKEENGSAQP
HSVQICALLDSEGTPLEVAYVARKLVEEGFSAIKLKVGRRVNSVQDALVMQEVRRAVGDQ
TELRADANCRWTFEEATKFGLLVKSCNLKYIEEPVQNKDDLIRFYEETGLPVALDETLDD
FEECPLRMLTKYVHPGIVAVVIKPSVVGGFENAALIARWAQQHGKMAVISAAYESGLGLS
AYILFASYLEMENVKASTEQKQGTTPFVAHGLGTYRWLSEDVMMNTLGIFRSPYSGFIEG
SAADASKNLKDVEINNDVIVRTSKGVPVRRYEVRVDRDGFSHFIRIHDTGEIAEGSVVLF
LHGFLGTGEEWISIMKGISGSARCISVDIPGHGRSRVQSHANETQTAPTFSMEMVAEVLY
KLIEQITPGKVTVVGYSMGARIALYMALRFSNKIEGAVVVSGSPGIKDPVARKVRRATDD
SKARMMIDHGLENFLESWYNGGLWKSLRRHPHFRKIVASRLLHDDVLSVAKLLSDLSSGR
QPSLWDELENCDTNISLVFGENDVKFKQIATKMYREMSKSKKRENNIIEMVEIPEAGHAV
HLESPLGVVLALRKFLTRVHKRYTETELSEKLLVALKEI
NT seq 5160 nt NT seq  +upstreamnt  +downstreamnt
atgcgatcttcgtttatagtctcgaatcctccgtttcttccttctctaatccctcgtcac
agttccagaaactcctttagacgtagcagagaacgacgcttctcctcctttgctgagtct
cttcgtgtttctcttcatggaatcggaagaaacatccaggtcgtcgctcaaggagttcaa
ttcgatggtccgattatgagtagagatgatgctttagaggttaatttggatgatgattta
atggttcaagtgtgtgtgactcgtaccttgtctccagctttgactcttgagcttggactc
gagagtctcaaagaagctgtggacgaattgaagactaatcctcctaagtcatcttgtggc
gtcttgcgatttcaagtggctgtgcctccaagggcaaaagctttgttctggttttgctct
caaccaacatcttccagtgtgtttcctgtttttttcctctccaaggaaaccgtggagcct
tcttataaatcactctatgttaaagaacctcatggggtttttgggattgggaatgcattc
tctttcgttcatccatcgtcaatcgactccaagggacataggaaaacattcctctcagat
gaatcagctatggtgacggcctatggatttctagatattgatttcaacgagcactctact
gtaaatagcaaggatggctcttcttactttttcgttcctcagattgagttagatgagcgt
gaggagatctctatattagcagttacactggcatggaatgattctctctcttacagtttc
gagcaaacgatttgttcatatgagaaatccttttttcaggtttcttgtcatctctgccca
aatttagaggagcattggttcaaacatttaaaaagttctattgcaaagtttagtgcaaaa
gagatacatccaattgagatggagcatatgaggtttttcacattttctgagatagatcag
gctgacgccaaggaactgaagaatatccgctcgtcatgtcagttccattgcaagctttca
cctggcgtttttttctctaacaacatgctgaatccggaggctgaagtgagtagcttcttg
aaagatgaggctaacatcaatgctgtctgggcgtcagctataattgaagaatgcactcgt
cttggtttgacgtatttttgtgtagctcctggatcgaggtcttcccatcttgcaattgct
gctgctaaccatccccttacaacgtgtcttgcatgctatgatgaaagatctcttgccttt
cacgctattggttatgctaaaggatccctcaaaccagcagtcattataacatcatcagga
actgccgtttcaaatcttcttccagcggtggttgaagccagtgaggattttataccactg
ctactacttactgcagatcgtcctcctgaactccagggtgttggcgcgaatcaagcaatt
aatcaagtaaaccacttcggttcgtttgtcagattcttcttcaatcttcctcctccaact
gatcttattccagtccggatggtccttactactatagactctgctatacattgggcaact
ggttctgcttgtggaccagtacatctcaattgtccttttagagatccacttgatggtagt
ccaacaaattggtcatcagactgcttaaatggattagacatttggatatctaatgctgaa
ccattcacaaaatatattcagttgcaaagccttgaaagcaatggtataacaactggccag
attaatgaggttttacaagtaatcaaagaggctaagaagggtctctttctaattggtgca
atccattcggaggatgaaatttgggcttcgcttctgttggctaaagagctgatgtggcct
gtagttgcagatgtcttatctggcgtacggctgcgcaagctttttaaaccttttcttgag
aagtggtcccctgcttttgttgatcattttgatcttgccctgctttcagattctgttagg
gatttgatggagtttgatgttgttatccaggttggaagtcggataacaagtaaaagagtt
tctcaggtgctaacgaaatgctttccgtttgcatacattttggttgataagcatccatgc
cgacatgacccatcacacctggtcactcacagggtccaaagcaacattgttcagtttgct
gattgtgtgcttaaatctcgatttccatggaggagaagcaagttgcatggtcatctacag
gcattggatggcgctattgcccgggaaatgtcatttcaaatatctgctgaaagctccctg
accgaaccttacgttgcacatatgctttctaaagcactaacttccaaatctgctcttttc
atcgggaatagcatgccaataagggatgtggatatgtatggatgtagttcagaaaattat
tctcatgtggtagatatgatggtgagtgcagaactaccatgtcaatggatacaagtaact
ggaaatagaggagctagtggcattgatgggttgctcagctcggccactggctttgctgtt
ggatgcaagaagagagtggtctgtgtggtgggggacatctctttccttcatgatacaaat
ggattggcgattttgaaacagaggatttcaaggaaaccaatgacaattcttgtgataaac
aaccgtggtggtggaatcttccgacttctccctattgcaaagagaacagagcctagcgtg
ttgaatcagtatttctatacatcacatgacgtttccattgaaaacttgtgtttggcacat
ggtgtgaggtatgtacacgttgggacgaaaagtgaacttgaggatgctctagttgtaccc
agcgtggaagagatggattgcattgtggaggttgaaagctctataaacgctaacgcaatc
gttcatagcactttggaaaggtttgcacgccaagctgcagaaaatgcgctgggcattatc
tcggccagttctctttgtcatccgatgattggaaatgtacttgtttgccaagtctctgga
atacaatattcgcagtacagagtcaaactgtgtgacagacctaccatatgttctgatgag
ttctctcaattccatcgagaagggttcatactctccttgactttggaggatgggagtatt
ggctacggagaggttgcacctctagacagtaatgtagagaacttaatggatgttgagggg
caacttcagttagttcttcacctcatggatggagctaaattttcttacatgcttcctttg
ttaaatggctcaatttcttcctggatttggagtgagcttggaattaatgcatcatcgatt
ttcccgagtgtcagatgtggtcttgaaatggctcttctaaatgcaatggcagtaagacat
gattctagtttgttggggatacttcattatcagaaagaagaaaatggttctgctcaacca
cactctgttcaaatatgtgcccttcttgattctgaaggtactccattggaggtcgcatac
gttgctagaaaacttgttgaagaagggttcagtgctattaaacttaaagttggtcgtcga
gtaaactctgttcaagatgctttagttatgcaagaagtaaggagagccgttggtgaccaa
actgaactccgtgcagacgcaaattgtcgctggacttttgaagaggctacaaagtttggt
ttattagtgaaaagctgtaatttaaaatatattgaggaacctgtccagaataaagatgac
cttataaggttttacgaagaaactggattaccagtggcacttgatgagactcttgatgat
tttgaggaatgtcctctacgtatgcttaccaaatatgtccatcctggaatagttgctgtt
gttattaaaccaagtgttgtgggagggtttgagaatgcagcactgattgctcggtgggca
cagcagcatggaaagatggctgttataagtgccgcatacgaaagtggcctaggtttatca
gcatatattttatttgcatcatatttggagatggagaatgtcaaagcttccacagagcag
aagcaaggaacgaccccttttgtagcccatggtctcggaacgtaccggtggcttagtgaa
gatgtaatgatgaatactttaggaatattccgtagcccttacagcggatttatcgaagga
tctgctgctgatgctagtaaaaatctaaaggatgttgagataaacaacgatgttattgtg
agaaccagtaaaggggttcctgtccggaggtatgaagtgagggtggatagagatggtttc
tctcatttcataagaatccacgacactggagaaattgcggaaggaagtgtagttttgttt
cttcatggatttcttggaaccggtgaagaatggatctccatcatgaagggtatctcggga
tctgcgagatgcatttcagtcgatattcctggtcatggaaggtcaagggtacaaagtcat
gctaatgagacccagacagccccaactttctcaatggagatggtagcagaggtcttgtat
aagttgatcgagcaaattactcctgggaaagttaccgtagttggatattcaatgggagca
agaatcgcactgtacatggctttgaggtttagcaacaagatcgaaggagctgtcgtggta
tcgggaagccccgggatcaaggatccagtggcaaggaaagttcgaagagcaacagatgat
tctaaagcacgaatgatgattgaccatggactagaaaactttctggagagctggtacaat
ggaggcttgtggaagagcttgagaaggcacccccattttagaaaaatagttgctagccgc
ttgctacatgatgatgtccttagcgttgcaaagctcctctcggatctaagcagtgggaga
caaccgtcattgtgggatgagttggagaattgtgatacaaatatttctcttgtcttcgga
gagaatgatgtcaaatttaaacaaatcgctacaaaaatgtaccgcgagatgagtaaaagc
aagaagagagaaaacaatatcatcgagatggttgaaatcccagaagctggtcacgctgtc
catctcgagagccctcttggcgtggttctcgcccttagaaaattcttaacaagagtgcac
aaaaggtatacagagacggagctttctgagaagcttctagtagcactaaaagaaatttaa

DBGET integrated database retrieval system