KEGG   Camelina sativa (false flax): 104788457Help
Entry
104788457         CDS       T05044                                 

Definition
(RefSeq) putative glucose-6-phosphate 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00010  Glycolysis / Gluconeogenesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104788457
Enzymes [BR:csat01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     104788457
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim GDE_N_bis
Motif
Other DBs
NCBI-GeneID: 104788457
NCBI-ProteinID: XP_010512513
Position
5
AA seq 320 aa AA seqDB search
MGHYATVVWDQKEATEIIKDWNGIDQVLLRNPHGASAKISLHGGQVISWRNELGEELLFT
SNKAIFKPPKSMRGGIQICYPQFGDCGLLDQHGFARNKIWVIDENPPPLHSNNEPSSVKS
FVDLLLKPSEDDLKQWPHSFEFRLRVSLAVDGDLTLVSRIRNINGKPFSFSFAYHTYLSV
SDISEVRVEGLETLDYLDNLSKRELLTEQGDAITFESEMDRTYLKSPKVVAVLDHERKRT
YVIGKEGLPDTVVWNPWEKKSKTMADFGDDEYKSMLCVNGAAVERPITLKPGEEWTGRLM
LTAVKSSFCFDQLELQSKGF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgggtcattacgcaacagtagtgtgggatcaaaaagaagctactgagattatcaaagat
tggaatggcattgaccaagtccttctcagaaacccacatggtgcttctgctaagattagt
ttacatggagggcaagtgatttcatggcggaatgaactaggcgaagagcttcttttcact
agcaacaaggctatattcaaacccccaaaatcaatgcgtggagggattcagatttgttat
cctcagtttggggattgtggattgttggatcaacatggttttgccaggaacaaaatctgg
gttatcgatgagaatccacctcctcttcactccaacaacgaaccatcctctgtcaaatct
tttgttgatcttcttttgaaaccttctgaagacgacttaaagcaatggcctcatagtttc
gagttccgtcttcgggtttcacttgctgttgatggcgacttaaccttagtttctcggatt
cgaaacatcaatggcaagccctttagcttctcttttgcatatcacacttacctctctgtc
tctgacatcagtgaagtgagagttgaagggttggagacactcgactacttagacaacctc
agcaaaagagagcttttgactgaacaaggcgatgcaataacctttgaatccgagatggac
cggacttaccttaaatcaccaaaggtagttgcagttcttgatcatgaacgaaaaagaacg
tatgttattggaaaggaaggacttccagacactgttgtatggaatccatgggaaaagaaa
tctaaaacaatggcggattttggggatgatgagtacaaaagcatgctctgtgtgaatggt
gcagctgttgagagaccgatcactttgaagccaggagaagaatggactggccggcttatg
ttgaccgcggttaaatctagtttctgcttcgatcaactcgaactacagagcaaaggattc
tga

DBGET integrated database retrieval system