KEGG   Camelina sativa (false flax): 104792763Help
Entry
104792763         CDS       T05044                                 

Definition
(RefSeq) caffeoylshikimate esterase-like
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00561  Glycerolipid metabolism
csat01100  Metabolic pathways
Module
csat_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:csat00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    104792763
Enzymes [BR:csat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     104792763
Peptidases [BR:csat01002]
 Serine Peptidases
  Family S33
   104792763
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_2 Peptidase_S9 DLH Esterase FSH1
Motif
Other DBs
NCBI-GeneID: 104792763
NCBI-ProteinID: XP_010517285
Position
6
AA seq 317 aa AA seqDB search
MTSATEDLKYEESFIKNTRGLKLFTCRWVPTNKDPRALVFLCHGYGMECSITMNSTARRL
VKAGYAVYGMDYEGHGKSDGLSAYIPNFDNLVDDVSTHYTTICEREENKRKMRFMLGESM
GGAVVVLLCRKKPDFWDGALLVAPMCKIAEEMKPSPFVISILTKLISVIPKWKIIPSQDI
IEISYKEPDIRKQVRENPLCYKGRPRLKTAYELLRISNDLEKRLQEVSLPFMVLHGDDDK
VTDKAVSQELYKVALSSDKTLKLYPGMWHGLLNGETQENIEIVFADVIGWLEKRSDYGNE
RFESELKHYSDGLNFKE
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgacgagtgcaacagaggacctcaagtatgaagagagtttcataaagaacactcgagga
ttgaagttgttcacgtgcagatgggtaccaacaaacaaagacccaagggctttagttttc
ctttgccacggatacggcatggaatgtagcatcaccatgaatagtactgcgaggagactt
gtgaaggcaggatatgcggtttatggaatggattatgaaggacatggcaaatctgatggg
cttagcgcttatatcccaaactttgacaacctcgttgatgatgtctcaactcattacaca
actatttgcgagagggaagagaacaaacggaagatgaggtttatgttaggagagtcaatg
ggaggagcagtggttgtgttgctatgcaggaagaaacctgacttttgggatggagctctc
ttggtcgctccaatgtgtaagatcgcagaagaaatgaagccaagtccttttgttatttcg
atattaacaaagctcatctcggttatacccaaatggaagatcattcctagtcaagatatc
atcgagatatcatataaagagccagacataaggaaacaggttcgagaaaatcctttatgt
tacaaaggaagaccacgcttgaaaactgcgtatgagcttttaaggatcagcaacgacctg
gagaagagacttcaagaggtttcattgccgtttatggttttacacggagatgatgataaa
gttacagataaagcagtgagccaagaactatacaaggttgcgttgagctctgacaaaacc
ttaaagttgtaccctgggatgtggcacggtttgctcaatggtgaaacacaagagaacatc
gaaattgtcttcgctgacgtcattggatggttggaaaaaagaagtgattatggaaatgaa
aggtttgagtcggagcttaaacattatagcgatggtttgaatttcaaggaatag

DBGET integrated database retrieval system