KEGG   Camelina sativa (false flax): 104793731Help
Entry
104793731         CDS       T05044                                 

Definition
(RefSeq) receptor-like serine/threonine-protein kinase SD1-8
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
csat  Camelina sativa (false flax)
Brite
KEGG Orthology (KO) [BR:csat00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csat01001]
    104793731
Enzymes [BR:csat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104793731
Protein kinases [BR:csat01001]
 Serine/threonine kinases: TKL group
  IRAK family
   104793731
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: S_locus_glycop Pkinase_Tyr PAN_2 Pkinase Mid2 Cadherin_C_2 TMEM237 Rax2 EphA2_TM Lipase_3
Motif
Other DBs
NCBI-GeneID: 104793731
NCBI-ProteinID: XP_019082442
Position
6
AA seq 389 aa AA seqDB search
MKFPRIFISEGEEAIKKYRSGGWNGIEFADVPMVFNSSNQDGQTSFLFQDTNPYSRVTLT
FRGILMWYTWDITSQEWITRWSAPITNCDQYNHCGTNSYCDGNMCKCIKGFEPNIAGGGC
FRKKPLSCDSNRFCLFTRMKLPDTMDANIYTSHEKKSCRHMCINDCHCTAYTLIVYQNGT
LSSNCVTWSKDLVDVQTYAQAGQDLYIRLNGKKKNKKWLIIGLSVGAAAALIIIIIVVLV
CIWKRKQKLARATAVNENVMESQTEENIFGAEDIGTPQLPPMDFGTILSATENFSDANEI
GHGGFGTVYKGCLPSGQAIAVKRLSEISRQGTVEFKAEVMLIANLQHINLVRLLGWSVHE
DERVLVYEYLENGSLHHRLFGDFFIQYMI
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttcctaggattttcatctccgagggagaggaagctatcaaaaagtatcggagc
ggcggttggaatggtatcgaattcgctgacgttcccatggttttcaattcaagtaatcaa
gatggtcagacgtcttttttgtttcaagacaccaacccttattctagagtcacattgacg
ttcagaggtattttgatgtggtatacgtgggatataacatcacaagaatggatcactcga
tggagtgcaccaattacaaattgtgatcagtataaccattgtggcaccaacagttactgc
gacgggaacatgtgtaagtgcatcaaagggtttgagccaaacatcgcaggaggaggatgt
tttagaaaaaaaccgctgagctgcgatagcaacaggttttgtctcttcaccagaatgaag
ttgccggatacaatggatgcaaatatatatacctcacacgaaaagaaaagttgtcgtcat
atgtgtatcaatgactgccactgcacggcttatacactgattgtctatcaaaatggcact
ttatcatcaaactgtgtgacttggagcaaagacctcgtggatgttcaaacttacgcccaa
gcaggtcaagatttgtacatcagactcaatggaaagaagaagaacaaaaagtggcttatc
ataggtctgagcgttggagccgctgctgctctcatcatcattataattgtggtactggtt
tgtatttggaaaaggaaacaaaagttagcaagagcgactgcagtaaatgaaaatgttatg
gaatcgcaaaccgaagaaaatatctttggagcagaggatatagggactccgcaacttcca
cccatggattttggaacaatattaagcgccacagagaacttctctgatgctaatgagatt
ggacatggtggattcggtactgtatataagggatgtttacctagcgggcaagcaattgcg
gtgaaaagactctctgagatctcaagacaagggactgtggagttcaaagccgaggtgatg
ttaattgcaaacctccagcatatcaatctagttagacttcttggttggagcgttcacgag
gatgagagggtcttggtatatgaataccttgaaaacggaagcctccaccatcgacttttt
ggtgacttctttatacaatatatgatataa

DBGET integrated database retrieval system