KEGG   Camelina sativa (false flax): 109124533Help
Entry
109124533         CDS       T05044                                 

Definition
(RefSeq) putative glucose-6-phosphate 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00010  Glycolysis / Gluconeogenesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109124533
Enzymes [BR:csat01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     109124533
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim GDE_N_bis
Motif
Other DBs
NCBI-GeneID: 109124533
NCBI-ProteinID: XP_010433867
Position
10
AA seq 307 aa AA seqDB search
MEPSSGVGAEKRPPTVDLVKDKNGTDQILLQNPKGASVKISLHGGQVLSWKTEKGDELLF
NSTKANSKPPHPVRGGIPICFPQFGTRGSLEQHGFARNKMWLVENNPPALPSFDSTGKAF
VDLVLKSSDEDTMRIWPHSFEFHLRVSLALDGNLTLISRVRNINSKPFSFAIAYHTYFSI
SDISEVRLEGLETLDYLDNLHEKERFTEQGDALTFESEIDRVYLNSKDVVAVFDHERKRT
FLIRKEGLPDVVVWNPWEKKARALTDLGDDEYKHMLCVDGAAIEKPITLKPGEEWTGKLN
LSLVLST
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggaaccatcttctggagtcggtgctgagaagagaccaccaaccgttgacttggtcaag
gataaaaatggaaccgatcagattcttcttcagaatcctaaaggcgcttctgttaagatt
agtttacatggaggacaagttctttcttggaagactgagaagggtgatgaattgttattc
aacagcaccaaggccaactcgaagcctccccatccggtacgaggaggaatccctatatgc
tttcctcagtttggaactcgaggatcactcgagcaacacgggtttgcaagaaacaagatg
tggcttgtggaaaacaatccacctgctttaccttcatttgactcaaccggtaaagccttt
gtcgatttggtacttaagtcatccgatgaagacactatgaggatctggcctcacagcttt
gagtttcacctgagagtctcattggcattagatgggaacttaacactgatatcacgagtc
agaaacatcaattcaaagccttttagctttgccattgcctatcacacttacttctccatt
tccgatattagtgaagttagacttgaagggctggaaactctcgactatcttgataacttg
cacgagaaagaacgttttacagagcaaggcgatgcactaacctttgaatctgagatcgat
agagtgtacctaaattctaaagacgtggttgctgttttcgaccatgaaagaaaacgcaca
ttccttatcaggaaagaaggtctacccgatgttgtggtatggaatccatgggagaagaaa
gctagagcactgacggatttgggagatgatgagtataaacacatgttgtgtgttgatgga
gcagccattgagaaacccatcactttgaaaccgggtgaagaatggaccggtaaattaaac
ctctcgcttgtcctatccacctga

DBGET integrated database retrieval system