KEGG   Camelina sativa (false flax): 109124814Help
Entry
109124814         CDS       T05044                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5 isoform X1
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
csat  Camelina sativa (false flax)
Pathway
csat03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:csat00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    109124814
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:csat03041]
    109124814
Enzymes [BR:csat01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     109124814
Spliceosome [BR:csat03041]
 Complex C
  Other components
   Step II factors
    109124814
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 AAA_19 AAA_30 T2SSE AAA Sigma54_activ_2 Flavi_DEAD ABC_tran PhoH
Motif
Other DBs
NCBI-GeneID: 109124814
NCBI-ProteinID: XP_010425360
Position
9
AA seq 1179 aa AA seqDB search
MEKEELNKLNHLSLVSNVCNELETHLGSAEKVLAEFIIDLGRHSDTVDEFDKKLKEQGAE
MPDYFVRSLLTVIHAIYPPKPKSEKKREEGEDVKFKGLAIKDTKDKVKELEKEIEREAEE
RRRAEDGNRDRERGRDRRDSGRDRDRDRDRGRDRNRDDRRDRHRDDRERHRGDEEGEDDR
RSDRRHRDRGRGDEEGEDRRRDRRAKDEYVEEDRGGAIANEPELYQVYKGRVTRVMDAGC
FVQFDKFRGKEGLVHVSQMATRRVEKPKEFVKRDMEVYVKVISNSNDKLSLSMRDVDQNT
GRDLIPLRKPSDEDDSSRSNPSYRTKDGQVTKTGISGIRIVEENDVAPSRRPLKKMSSPE
RWEAKQLIASGVLRVDEFPMYDEDGDGMLYQEEGAEEELEIEMNEDEPAFLQGQTRYSVD
MSPVKIFKNPEGSLSRAAALQSALTKERREMREQQQRTMLDSIPKDLNRPWEDPMPETGE
RHLAQELRGVGLSAYDMPEWKKDAFGKTPTFGQRSKLSIQEQRESLPIYKLKKELIQAVH
DNQVLVVIGETGSGKTTQVTQYLAESGYTTRGKIGCTQPRRVAAMSVAKRVAEEFGCRLG
EEVGYAIRFEDCTGPDTVIKYMTDGMLLREILIDENLSQYSVIMLDEAHERTIHTDVLFG
LLKKLMKRRLDLRLIVTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPETDYLDA
ALITVLQIHLTEPEGDILVFLTGQEEIDSACQSLYERMKGLGKNVPELIILPVYSALPSE
MQSRIFDPPPPGKRKVVVATNIAEASLTIDGIYYVVDPGFAKQNVYNPKQGLESLVITPI
SQASAKQRAGRAGRTGPGKCYRLYTESAYRNEMPPTSIPEIQRINLGMTTLTMKAMGIND
LLSFDFMDPPQPQALISAMEQLYSLGALDEEGLLTKLGRKMAEFPLEPPLSKMLLASVDL
GCSDEILTMIAMIQTGNIFYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSG
PWCFENFIQSRSLRRAQDVRKQLLSIMDKYKLDVVSAGKNFTKIRKAITAGFFFHGARKD
PQEGYRTLVENQPVYIHPSSALFQRQPDWVIYHDLVMTTKEYMREVTVIDPKWLVELAPR
FFKVSDPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA
NT seq 3540 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagaagagcttaacaaattgaatcacctctctctcgtatccaatgtctgcaac
gagttagaaacgcatctaggatctgcggagaaagttttggcagaattcatcatcgatctc
ggtcgtcactccgatactgtagatgaattcgataagaagctcaaggagcaaggtgcggag
atgcctgattacttcgtccggtcgctgttaactgtaatccacgcgatttatcctccgaag
cctaagtctgagaagaagagagaggaaggtgaggatgttaaattcaaaggtttggcgatt
aaggatactaaggataaagtcaaggagcttgagaaggagattgaaagagaagctgaggag
cgacggagagcggaggatgggaatagggatagagagaggggtcgggatcggagggattcg
ggtagggatagggatagggatagagatagaggtagagataggaatcgtgatgatagaagg
gatcgacatagggatgatagagagagacaccgtggagatgaggaaggtgaagatgataga
agaagtgataggaggcatagagatagaggtcgtggcgatgaggaaggggaagataggcgt
agagataggcgtgctaaggatgagtatgtggaggaagatagaggcggtgcgattgcgaat
gagcctgagttgtatcaggtatacaaagggagggttactagggttatggatgctggttgt
tttgttcagtttgataaatttaggggaaaggaaggtcttgttcatgtttctcagatggct
actagaagggttgagaagcctaaggagtttgtgaagcgggatatggaggtttatgtgaaa
gtgatatctaattcgaatgataagttaagtctttctatgagagatgttgatcagaatacg
ggtagagatttgattcctctgaggaagccttcagatgaggatgattcgtccaggagtaat
ccttcgtataggacaaaggatggacaagtaactaagactgggatttcgggaatcaggatt
gtagaggagaatgatgttgcaccttcacgtaggccattgaagaagatgagctctcctgag
agatgggaagcgaaacagttgattgcctctggtgtcttgagagttgatgagtttccaatg
tatgatgaggatggagatgggatgctttatcaagaggaaggtgctgaagaagaacttgag
attgagatgaatgaagacgaacctgctttcttacaagggcaaactaggtactctgttgac
atgtctccggttaagatcttcaaaaatccagaaggttccttgagtcgcgcagctgcactt
cagtccgccctcaccaaggagaggagagaaatgagggaacagcagcaaagaacaatgctt
gactcaatcccaaaggatctgaatcgtccatgggaagaccctatgcctgaaactggtgaa
aggcatcttgctcaagagcttagaggtgttgggttatcagcttatgacatgcctgagtgg
aagaaggatgcctttggaaaaactcctacttttggacagagatcgaagctttctattcag
gaacaaagggagagccttccaatatacaagttgaaaaaagaacttatacaggctgtgcat
gataatcaagttttggtggtcattggtgagactgggtctggaaagacaacacaggtaact
caatatcttgccgaatcaggttacacaacaaggggaaagatcgggtgtactcagcctcgt
agggttgctgcgatgtctgttgccaagagagtagctgaggagtttggttgtcgtttagga
gaggaggtagggtatgcgattcggtttgaggattgtactggaccagatacagtgatcaag
tacatgactgatggtatgcttcttagggagattctgatagatgaaaacctctctcaatac
tctgtaatcatgcttgatgaagctcacgagcggacaatccacactgatgtgctgtttggt
cttctaaagaagctgatgaaacgtcgacttgatcttcgtctgattgtcacgtctgccaca
ttggatgcagagaagttctctgggtatttcttcaactgcaacatctttaccattcctgga
agaacctttcctgttgagatactgtataccaaacagccagaaacagattacttggatgca
gctctgatcacagtccttcagattcacttaactgaacctgagggtgacattctcgtcttc
ttgactggacaggaagaaatcgattctgcatgccaatctctatacgagagaatgaaaggt
ctaggtaaaaatgttcctgaactcatcatacttccagtttacagtgcccttcctagtgaa
atgcaatctagaatatttgatcctccacctcctggtaaacggaaagtggttgtagctaca
aatattgcagaagcttctttaacaatagatggtatatactatgttgttgatcctgggttt
gcaaagcagaacgtgtacaatccaaagcaagggctagaatcgctagtcattactccaatc
tcacaggcatcggccaagcaaagagctggacgtgctggtcgtactgggcccgggaaatgt
taccgtctctacacggaaagcgcatatcgtaatgagatgcctcctacatcaatccctgaa
attcaaagaattaatcttggaatgacaaccctgaccatgaaagccatgggtattaatgac
ctgctatcgtttgacttcatggatccacctcaaccacaagcattgatctctgcaatggaa
cagttgtacagcctgggagctttggatgaagaaggtttgttgacgaagcttggtagaaaa
atggcagagtttcctcttgaaccgccgctttctaaaatgttgctagcaagtgtggatctc
gggtgcagcgatgagattttaacgatgattgctatgatccagacgggcaacatattttat
agaccgagggagaagcaagctcaggcagaccaaaaacgggcaaagtttttccagcccgag
ggtgatcacctgacattactggctgtatatgaggcgtggaaggccaaaaacttctcaggt
ccatggtgttttgaaaatttcattcagtcaagatcgttacgacgtgctcaagatgtgagg
aaacaacttctcagcattatggacaaatataaactagatgtggtgagtgcggggaagaat
ttcacgaagataaggaaagcaatcacggcaggattcttcttccatggagcaaggaaagat
ccacaggaaggttacaggacactagtggagaatcaaccggtgtatatacacccgagcagc
gcgctgttccagagacaaccagactgggttatatatcatgatcttgtgatgacgaccaaa
gagtacatgagggaagtaactgtgattgacccaaagtggcttgttgagttagctccaagg
tttttcaaagtctctgacccaacgaaaatgagcaagcgcaagcgccaagaacgcattgag
cctttgtatgaccggtaccacgagcctaactcatggcgtctcagcaaaagacgtgcttga

DBGET integrated database retrieval system