KEGG   Camelina sativa (false flax): 109125101Help
Entry
109125101         CDS       T05044                                 

Definition
(RefSeq) probable LRR receptor-like serine/threonine-protein kinase At2g23950
Organism
csat  Camelina sativa (false flax)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 109125101
NCBI-ProteinID: XP_019101415
Position
5
AA seq 198 aa AA seqDB search
MTMEKSRGSCLCCMLLKPRTLLMRWSVLAAKQNTVDVQLLSSPLTNSTRVTYLMRKLLFL
LSPLQGKETLLIQRTSCSYGWFSSKSILGDGGFGNVYRGKLGDGTVVAVKRLKDVNGTSR
NSQFRTELEMISLAVHRNLLRLIGYCVSSNERLLVYPYMSNCSVASRLKAKPALDWNTRK
KIAIGAARGGFVIVTWLN
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgacgatggagaaaagccgaggaagctgcttgtgttgtatgcttctaaaaccgagaacg
ctcttgatgcggtggagcgtattggccgcgaagcagaacaccgtggatgtccaacttcta
tcgtctccactgacgaattcgacgcgagttacttacctcatgaggaagctgttgtttttg
ttgtctccactacagggcaaggagactctcctgattcagagaacttcatgtagctacgga
tggtttagttccaagagcattcttggtgatggtgggtttggtaatgtctacagaggaaag
cttggagatgggacagtggttgcagtgaaacgactgaaagatgtgaatggaacttctcgg
aactcacagtttcgtaccgagcttgagatgatcagcttagctgtccataggaatttgctt
cggttaattggttattgcgtgagttctaacgaaagacttcttgtctacccttacatgtcc
aattgtagtgtcgcctctaggcttaaagctaaaccagcattggactggaacacaaggaag
aagatagcaataggagctgcaagaggaggttttgttatagtcacttggctcaactaa

DBGET integrated database retrieval system