KEGG   Camelina sativa (false flax): 109125899Help
Entry
109125899         CDS       T05044                                 

Definition
(RefSeq) arogenate dehydratase 5, chloroplastic-like
  KO
K05359  arogenate/prephenate dehydratase [EC:4.2.1.91 4.2.1.51]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00400  Phenylalanine, tyrosine and tryptophan biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    109125899
Enzymes [BR:csat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     109125899
    4.2.1.91  arogenate dehydratase
     109125899
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDT
Motif
Other DBs
NCBI-GeneID: 109125899
NCBI-ProteinID: XP_019084230
Position
8
AA seq 235 aa AA seqDB search
MQTISPVFSCDLKSVIQPNLTAKIGRFSHVNGKRVSVRCGYRSESFSFPNGVGSSRADWQ
SSCAILASKVVSAENSSSIADQVAVVNGHSNGSVDLSIVPSKNGKPGLVQPLTITDLSPA
PSHGSTLRVAYQGVPGAYSEAAAGKAYPNSEAIPCDQFDVAFQAVELWIADRAVLPVENS
LGGSIHRNYDLLLRHRLHIVGEVQIPVHHCLLALPGVRTDCITRVKDLTDLPSNT
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccatttcgcctgtgttctcgtgcgatctcaaatccgtaattcaaccgaatcta
acggctaagattgggcgtttctctcacgtaaatggaaagcgcgtgtctgttcgttgcggt
tacaggtctgagtcgtttagtttccctaacggtgttggctcgagtcgagctgattggcaa
agctcatgcgccatcttagccagcaaagtagtctcggctgagaattcaagctccatcgcc
gatcaagtcgccgtcgttaacggacacagtaacggctccgtcgatctaagcatcgttcca
tcgaaaaacgggaagcctggattggttcagccgttaacgattacggatctgtctccggcg
ccgtctcacggatctactctccgtgtagcgtatcaaggagttcccggcgcgtattccgaa
gcggccgccggaaaagcttacccgaactcggaagctatcccgtgtgatcagttcgacgtt
gcgtttcaggcggtggagctttggatcgccgatcgtgctgttctaccagttgagaactct
ctcggtggttcgattcatagaaattacgatctcctcctccgtcaccgtctccacatcgtc
ggagaagttcagatcccggttcaccactgtctcctcgcactccccggagtccgcacggat
tgcatcacgcgagtgaaggatttgacggatttaccctcaaatacttag

DBGET integrated database retrieval system